Anti CDKL2 pAb (ATL-HPA040672)

Atlas Antibodies

Catalog No.: ATL-HPA040672-25

Protein Description: cyclin-dependent kinase-like 2 (CDC2-related kinase)
Gene Name: CDKL2
Alternative Gene Name: KKIAMRE, P56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029403: 85%, ENSRNOG00000002506: 85%
Entrez Gene ID: 8999
Uniprot ID: Q92772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NLIPRHQELFNKNPVFAGVRLPEIKEREPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQMDGFAERFSQELQLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPK
• Gene Sequence: NLIPRHQELFNKNPVFAGVRLPEIKEREPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQMDGFAERFSQELQLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPK
• Gene ID - Mouse: ENSMUSG00000029403
• Gene ID - Rat: ENSRNOG00000002506
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.