Anti CDKL2 pAb (ATL-HPA040672)

Atlas Antibodies

SKU:
ATL-HPA040672-25
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & centrosome.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cyclin-dependent kinase-like 2 (CDC2-related kinase)
Gene Name: CDKL2
Alternative Gene Name: KKIAMRE, P56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029403: 85%, ENSRNOG00000002506: 85%
Entrez Gene ID: 8999
Uniprot ID: Q92772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NLIPRHQELFNKNPVFAGVRLPEIKEREPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQMDGFAERFSQELQLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPK
Gene Sequence NLIPRHQELFNKNPVFAGVRLPEIKEREPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQMDGFAERFSQELQLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPK
Gene ID - Mouse ENSMUSG00000029403
Gene ID - Rat ENSRNOG00000002506
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDKL2 pAb (ATL-HPA040672)
Datasheet Anti CDKL2 pAb (ATL-HPA040672) Datasheet (External Link)
Vendor Page Anti CDKL2 pAb (ATL-HPA040672) at Atlas Antibodies

Documents & Links for Anti CDKL2 pAb (ATL-HPA040672)
Datasheet Anti CDKL2 pAb (ATL-HPA040672) Datasheet (External Link)
Vendor Page Anti CDKL2 pAb (ATL-HPA040672)