Anti CDKL2 pAb (ATL-HPA040672)
Atlas Antibodies
- SKU:
- ATL-HPA040672-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CDKL2
Alternative Gene Name: KKIAMRE, P56
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029403: 85%, ENSRNOG00000002506: 85%
Entrez Gene ID: 8999
Uniprot ID: Q92772
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NLIPRHQELFNKNPVFAGVRLPEIKEREPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQMDGFAERFSQELQLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPK |
Gene Sequence | NLIPRHQELFNKNPVFAGVRLPEIKEREPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAELLHHDFFQMDGFAERFSQELQLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPK |
Gene ID - Mouse | ENSMUSG00000029403 |
Gene ID - Rat | ENSRNOG00000002506 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDKL2 pAb (ATL-HPA040672) | |
Datasheet | Anti CDKL2 pAb (ATL-HPA040672) Datasheet (External Link) |
Vendor Page | Anti CDKL2 pAb (ATL-HPA040672) at Atlas Antibodies |
Documents & Links for Anti CDKL2 pAb (ATL-HPA040672) | |
Datasheet | Anti CDKL2 pAb (ATL-HPA040672) Datasheet (External Link) |
Vendor Page | Anti CDKL2 pAb (ATL-HPA040672) |