Anti CDKL1 pAb (ATL-HPA065919)

Atlas Antibodies

SKU:
ATL-HPA065919-25
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cyclin-dependent kinase-like 1 (CDC2-related kinase)
Gene Name: CDKL1
Alternative Gene Name: KKIALRE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020990: 67%, ENSRNOG00000038720: 61%
Entrez Gene ID: 8814
Uniprot ID: Q00532
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNY
Gene Sequence TLRKSRKHHCFTETSKLQYLPQLTGSSILPALDNKKYYCDTKKLNY
Gene ID - Mouse ENSMUSG00000020990
Gene ID - Rat ENSRNOG00000038720
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDKL1 pAb (ATL-HPA065919)
Datasheet Anti CDKL1 pAb (ATL-HPA065919) Datasheet (External Link)
Vendor Page Anti CDKL1 pAb (ATL-HPA065919) at Atlas Antibodies

Documents & Links for Anti CDKL1 pAb (ATL-HPA065919)
Datasheet Anti CDKL1 pAb (ATL-HPA065919) Datasheet (External Link)
Vendor Page Anti CDKL1 pAb (ATL-HPA065919)