Anti CDK7 pAb (ATL-HPA007932 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA007932-25

• 
• 

Protein Description: cyclin-dependent kinase 7
Gene Name: CDK7
Alternative Gene Name: CAK, CAK1, CDKN7, MO15, STK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069089: 89%, ENSRNOG00000018510: 92%
Entrez Gene ID: 1022
Uniprot ID: P50613
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLI
• Gene Sequence: GCILAELLLRVPFLPGDSDLDQLTRIFETLGTPTEEQWPDMCSLPDYVTFKSFPGIPLHHIFSAAGDDLLDLIQGLFLFNPCARITATQALKMKYFSNRPGPTPGCQLPRPNCPVETLKEQSNPALAIKRKRTEALEQGGLPKKLI
• Gene ID - Mouse: ENSMUSG00000069089
• Gene ID - Rat: ENSRNOG00000018510
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDK7 pAb (ATL-HPA007932 w/enhanced validation) – 1 Found

Phan, Nhan; Hong, Jenny J; Tofig, Bobby; Mapua, Matthew; Elashoff, David; Moatamed, Neda A; Huang, Jin; Memarzadeh, Sanaz; Damoiseaux, Robert; Soragni, Alice. A simple high-throughput approach identifies actionable drug sensitivities in patient-derived tumor organoids. Communications Biology. 2( 30820473):78.