Anti CDK6 pAb (ATL-HPA002637 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA002637-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cyclin-dependent kinase 6
Gene Name: CDK6
Alternative Gene Name: PLSTIRE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040274: 92%, ENSRNOG00000009258: 92%
Entrez Gene ID: 1021
Uniprot ID: Q00534
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELN
Gene Sequence FRGSSDVDQLGKILDVIGLPGEEDWPRDVALPRQAFHSKSAQPIEKFVTDIDELGKDLLLKCLTFNPAKRISAYSALSHPYFQDLERCKENLDSHLPPSQNTSELN
Gene ID - Mouse ENSMUSG00000040274
Gene ID - Rat ENSRNOG00000009258
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDK6 pAb (ATL-HPA002637 w/enhanced validation)
Datasheet Anti CDK6 pAb (ATL-HPA002637 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDK6 pAb (ATL-HPA002637 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CDK6 pAb (ATL-HPA002637 w/enhanced validation)
Datasheet Anti CDK6 pAb (ATL-HPA002637 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDK6 pAb (ATL-HPA002637 w/enhanced validation)
Citations for Anti CDK6 pAb (ATL-HPA002637 w/enhanced validation) – 4 Found
Li, Zhiqiang; Razavi, Pedram; Li, Qing; Toy, Weiyi; Liu, Bo; Ping, Christina; Hsieh, Wilson; Sanchez-Vega, Francisco; Brown, David N; Da Cruz Paula, Arnaud F; Morris, Luc; Selenica, Pier; Eichenberger, Emily; Shen, Ronglai; Schultz, Nikolaus; Rosen, Neal; Scaltriti, Maurizio; Brogi, Edi; Baselga, Jose; Reis-Filho, Jorge S; Chandarlapaty, Sarat. Loss of the FAT1 Tumor Suppressor Promotes Resistance to CDK4/6 Inhibitors via the Hippo Pathway. Cancer Cell. 2018;34(6):893-905.e8.  PubMed
Müller, Anne; Dickmanns, Antje; Resch, Claudia; Schäkel, Knut; Hailfinger, Stephan; Dobbelstein, Matthias; Schulze-Osthoff, Klaus; Kramer, Daniela. The CDK4/6-EZH2 pathway is a potential therapeutic target for psoriasis. The Journal Of Clinical Investigation. 2020;130(11):5765-5781.  PubMed
Redl, Elisa; Sheibani-Tezerji, Raheleh; Cardona, Crhistian de Jesus; Hamminger, Patricia; Timelthaler, Gerald; Hassler, Melanie Rosalia; Zrimšek, Maša; Lagger, Sabine; Dillinger, Thomas; Hofbauer, Lorena; Draganić, Kristina; Tiefenbacher, Andreas; Kothmayer, Michael; Dietz, Charles H; Ramsahoye, Bernard H; Kenner, Lukas; Bock, Christoph; Seiser, Christian; Ellmeier, Wilfried; Schweikert, Gabriele; Egger, Gerda. Requirement of DNMT1 to orchestrate epigenomic reprogramming for NPM-ALK-driven lymphomagenesis. Life Science Alliance. 2021;4(2)  PubMed
Li, Qing; Jiang, Baishan; Guo, Jiaye; Shao, Hong; Del Priore, Isabella S; Chang, Qing; Kudo, Rei; Li, Zhiqiang; Razavi, Pedram; Liu, Bo; Boghossian, Andrew S; Rees, Matthew G; Ronan, Melissa M; Roth, Jennifer A; Donovan, Katherine A; Palafox, Marta; Reis-Filho, Jorge S; de Stanchina, Elisa; Fischer, Eric S; Rosen, Neal; Serra, Violeta; Koff, Andrew; Chodera, John D; Gray, Nathanael S; Chandarlapaty, Sarat. INK4 Tumor Suppressor Proteins Mediate Resistance to CDK4/6 Kinase Inhibitors. Cancer Discovery. 2022;12(2):356-371.  PubMed