Anti CDK5RAP3 pAb (ATL-HPA022882)

Atlas Antibodies

SKU: ATL-HPA022882-25

• 
• 

Protein Description: CDK5 regulatory subunit associated protein 3
Gene Name: CDK5RAP3
Alternative Gene Name: C53, FLJ13660, HSF-27, IC53, LZAP, MST016, OK/SW-cl.114
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018669: 87%, ENSRNOG00000048747: 86%
Entrez Gene ID: 80279
Uniprot ID: Q96JB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQV
• Gene Sequence: ITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQV
• Gene ID - Mouse: ENSMUSG00000018669
• Gene ID - Rat: ENSRNOG00000048747
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.