Anti CDK5RAP3 pAb (ATL-HPA022882)

Atlas Antibodies

Catalog No.:
ATL-HPA022882-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: CDK5 regulatory subunit associated protein 3
Gene Name: CDK5RAP3
Alternative Gene Name: C53, FLJ13660, HSF-27, IC53, LZAP, MST016, OK/SW-cl.114
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018669: 87%, ENSRNOG00000048747: 86%
Entrez Gene ID: 80279
Uniprot ID: Q96JB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQV
Gene Sequence ITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQV
Gene ID - Mouse ENSMUSG00000018669
Gene ID - Rat ENSRNOG00000048747
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDK5RAP3 pAb (ATL-HPA022882)
Datasheet Anti CDK5RAP3 pAb (ATL-HPA022882) Datasheet (External Link)
Vendor Page Anti CDK5RAP3 pAb (ATL-HPA022882) at Atlas Antibodies

Documents & Links for Anti CDK5RAP3 pAb (ATL-HPA022882)
Datasheet Anti CDK5RAP3 pAb (ATL-HPA022882) Datasheet (External Link)
Vendor Page Anti CDK5RAP3 pAb (ATL-HPA022882)