Anti CDK5RAP3 pAb (ATL-HPA022882)
Atlas Antibodies
- Catalog No.:
- ATL-HPA022882-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CDK5RAP3
Alternative Gene Name: C53, FLJ13660, HSF-27, IC53, LZAP, MST016, OK/SW-cl.114
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018669: 87%, ENSRNOG00000048747: 86%
Entrez Gene ID: 80279
Uniprot ID: Q96JB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQV |
| Gene Sequence | ITGENVRGELLALVKDLPSQLAEIGAAAQQSLGEAIDVYQASVGFVCESPTEQVLPMLRFVQKRGNSTVYEWRTGTEPSVVERPHLEELPEQV |
| Gene ID - Mouse | ENSMUSG00000018669 |
| Gene ID - Rat | ENSRNOG00000048747 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDK5RAP3 pAb (ATL-HPA022882) | |
| Datasheet | Anti CDK5RAP3 pAb (ATL-HPA022882) Datasheet (External Link) |
| Vendor Page | Anti CDK5RAP3 pAb (ATL-HPA022882) at Atlas Antibodies |
| Documents & Links for Anti CDK5RAP3 pAb (ATL-HPA022882) | |
| Datasheet | Anti CDK5RAP3 pAb (ATL-HPA022882) Datasheet (External Link) |
| Vendor Page | Anti CDK5RAP3 pAb (ATL-HPA022882) |