Anti CDK5RAP2 pAb (ATL-HPA035821)

Atlas Antibodies

Catalog No.: ATL-HPA035821-25

Protein Description: CDK5 regulatory subunit associated protein 2
Gene Name: CDK5RAP2
Alternative Gene Name: C48, CEP215, FLJ10867, MCPH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039298: 62%, ENSRNOG00000005788: 66%
Entrez Gene ID: 55755
Uniprot ID: Q96SN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NQHLKKTIFDLSCMGFQGNGFPDRLASTEQTELLASKEDEDTIKIGEDDEINFLSDQHLQQSNEIMKDLSKGGCKNGYLRHTESKISDCD
• Gene Sequence: NQHLKKTIFDLSCMGFQGNGFPDRLASTEQTELLASKEDEDTIKIGEDDEINFLSDQHLQQSNEIMKDLSKGGCKNGYLRHTESKISDCD
• Gene ID - Mouse: ENSMUSG00000039298
• Gene ID - Rat: ENSRNOG00000005788
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.