Anti CDK5RAP2 pAb (ATL-HPA035821)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035821-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CDK5RAP2
Alternative Gene Name: C48, CEP215, FLJ10867, MCPH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039298: 62%, ENSRNOG00000005788: 66%
Entrez Gene ID: 55755
Uniprot ID: Q96SN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NQHLKKTIFDLSCMGFQGNGFPDRLASTEQTELLASKEDEDTIKIGEDDEINFLSDQHLQQSNEIMKDLSKGGCKNGYLRHTESKISDCD |
Gene Sequence | NQHLKKTIFDLSCMGFQGNGFPDRLASTEQTELLASKEDEDTIKIGEDDEINFLSDQHLQQSNEIMKDLSKGGCKNGYLRHTESKISDCD |
Gene ID - Mouse | ENSMUSG00000039298 |
Gene ID - Rat | ENSRNOG00000005788 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDK5RAP2 pAb (ATL-HPA035821) | |
Datasheet | Anti CDK5RAP2 pAb (ATL-HPA035821) Datasheet (External Link) |
Vendor Page | Anti CDK5RAP2 pAb (ATL-HPA035821) at Atlas Antibodies |
Documents & Links for Anti CDK5RAP2 pAb (ATL-HPA035821) | |
Datasheet | Anti CDK5RAP2 pAb (ATL-HPA035821) Datasheet (External Link) |
Vendor Page | Anti CDK5RAP2 pAb (ATL-HPA035821) |