Anti CDK5RAP1 pAb (ATL-HPA066301)

Atlas Antibodies

SKU:
ATL-HPA066301-25
  • Immunofluorescent staining of human cell line CACO-2 shows localization to nuclear speckles & mitochondria.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma and human liver tissue.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CDK5 regulatory subunit associated protein 1
Gene Name: CDK5RAP1
Alternative Gene Name: C20orf34, C42, CGI-05, HSPC167
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027487: 89%, ENSRNOG00000015696: 86%
Entrez Gene ID: 51654
Uniprot ID: Q96SZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLKDDVPEEVKLRRLEELITIFREEATKANQTSVGCTQLVLVEGLSKRSATDLCGRNDGNLKVIFPDAEMEDVNNPGLRVRAQPGDYVLVKITSAS
Gene Sequence RLKDDVPEEVKLRRLEELITIFREEATKANQTSVGCTQLVLVEGLSKRSATDLCGRNDGNLKVIFPDAEMEDVNNPGLRVRAQPGDYVLVKITSAS
Gene ID - Mouse ENSMUSG00000027487
Gene ID - Rat ENSRNOG00000015696
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDK5RAP1 pAb (ATL-HPA066301)
Datasheet Anti CDK5RAP1 pAb (ATL-HPA066301) Datasheet (External Link)
Vendor Page Anti CDK5RAP1 pAb (ATL-HPA066301) at Atlas Antibodies

Documents & Links for Anti CDK5RAP1 pAb (ATL-HPA066301)
Datasheet Anti CDK5RAP1 pAb (ATL-HPA066301) Datasheet (External Link)
Vendor Page Anti CDK5RAP1 pAb (ATL-HPA066301)