Anti CDK5RAP1 pAb (ATL-HPA066301)
Atlas Antibodies
- Catalog No.:
- ATL-HPA066301-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CDK5RAP1
Alternative Gene Name: C20orf34, C42, CGI-05, HSPC167
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027487: 89%, ENSRNOG00000015696: 86%
Entrez Gene ID: 51654
Uniprot ID: Q96SZ6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RLKDDVPEEVKLRRLEELITIFREEATKANQTSVGCTQLVLVEGLSKRSATDLCGRNDGNLKVIFPDAEMEDVNNPGLRVRAQPGDYVLVKITSAS |
| Gene Sequence | RLKDDVPEEVKLRRLEELITIFREEATKANQTSVGCTQLVLVEGLSKRSATDLCGRNDGNLKVIFPDAEMEDVNNPGLRVRAQPGDYVLVKITSAS |
| Gene ID - Mouse | ENSMUSG00000027487 |
| Gene ID - Rat | ENSRNOG00000015696 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDK5RAP1 pAb (ATL-HPA066301) | |
| Datasheet | Anti CDK5RAP1 pAb (ATL-HPA066301) Datasheet (External Link) |
| Vendor Page | Anti CDK5RAP1 pAb (ATL-HPA066301) at Atlas Antibodies |
| Documents & Links for Anti CDK5RAP1 pAb (ATL-HPA066301) | |
| Datasheet | Anti CDK5RAP1 pAb (ATL-HPA066301) Datasheet (External Link) |
| Vendor Page | Anti CDK5RAP1 pAb (ATL-HPA066301) |