Anti CDK3 pAb (ATL-HPA007420)

Atlas Antibodies

Catalog No.:
ATL-HPA007420-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cyclin-dependent kinase 3
Gene Name: CDK3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025358: 49%, ENSRNOG00000006469: 49%
Entrez Gene ID: 1018
Uniprot ID: Q00526
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRFRH
Gene Sequence PSEDTWPGVTQLPDYKGSFPKWTRKGLEEIVPNLEPEGRDLLMQLLQYDPSQRITAKTALAHPYFSSPEPSPAARQYVLQRFRH
Gene ID - Mouse ENSMUSG00000025358
Gene ID - Rat ENSRNOG00000006469
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDK3 pAb (ATL-HPA007420)
Datasheet Anti CDK3 pAb (ATL-HPA007420) Datasheet (External Link)
Vendor Page Anti CDK3 pAb (ATL-HPA007420) at Atlas Antibodies

Documents & Links for Anti CDK3 pAb (ATL-HPA007420)
Datasheet Anti CDK3 pAb (ATL-HPA007420) Datasheet (External Link)
Vendor Page Anti CDK3 pAb (ATL-HPA007420)