Anti CDK2AP2 pAb (ATL-HPA047599 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA047599-25

• 
• 
• 

Protein Description: cyclin-dependent kinase 2 associated protein 2
Gene Name: CDK2AP2
Alternative Gene Name: DOC-1R, p14
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000097485: 96%, ENSRNOG00000018391: 96%
Entrez Gene ID: 10263
Uniprot ID: O75956
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMG
• Gene Sequence: SPSGSVPGAGAPFRPLFNDFGPPSMGYVQAMKPPGAQGSQSTYTDLLSVIEEMG
• Gene ID - Mouse: ENSMUSG00000097485
• Gene ID - Rat: ENSRNOG00000018391
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.