Anti CDK2AP1 pAb (ATL-HPA068833)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068833-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $447.00
    
         
                            Gene Name: CDK2AP1
Alternative Gene Name: doc-1, DOC1, DORC1, p12DOC-1, ST19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078154: 93%, ENSRNOG00000001070: 93%
Entrez Gene ID: 8099
Uniprot ID: O14519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | MSYKPNLAAHMPAAALNAAGSVHSPSTSMA | 
| Gene Sequence | MSYKPNLAAHMPAAALNAAGSVHSPSTSMA | 
| Gene ID - Mouse | ENSMUSG00000078154 | 
| Gene ID - Rat | ENSRNOG00000001070 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti CDK2AP1 pAb (ATL-HPA068833) | |
| Datasheet | Anti CDK2AP1 pAb (ATL-HPA068833) Datasheet (External Link) | 
| Vendor Page | Anti CDK2AP1 pAb (ATL-HPA068833) at Atlas Antibodies | 
| Documents & Links for Anti CDK2AP1 pAb (ATL-HPA068833) | |
| Datasheet | Anti CDK2AP1 pAb (ATL-HPA068833) Datasheet (External Link) | 
| Vendor Page | Anti CDK2AP1 pAb (ATL-HPA068833) | 
 
         
                            