Anti CDK2AP1 pAb (ATL-HPA068833)

Atlas Antibodies

Catalog No.:
ATL-HPA068833-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cyclin-dependent kinase 2 associated protein 1
Gene Name: CDK2AP1
Alternative Gene Name: doc-1, DOC1, DORC1, p12DOC-1, ST19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000078154: 93%, ENSRNOG00000001070: 93%
Entrez Gene ID: 8099
Uniprot ID: O14519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSYKPNLAAHMPAAALNAAGSVHSPSTSMA
Gene Sequence MSYKPNLAAHMPAAALNAAGSVHSPSTSMA
Gene ID - Mouse ENSMUSG00000078154
Gene ID - Rat ENSRNOG00000001070
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDK2AP1 pAb (ATL-HPA068833)
Datasheet Anti CDK2AP1 pAb (ATL-HPA068833) Datasheet (External Link)
Vendor Page Anti CDK2AP1 pAb (ATL-HPA068833) at Atlas Antibodies

Documents & Links for Anti CDK2AP1 pAb (ATL-HPA068833)
Datasheet Anti CDK2AP1 pAb (ATL-HPA068833) Datasheet (External Link)
Vendor Page Anti CDK2AP1 pAb (ATL-HPA068833)