Anti CDK2AP1 pAb (ATL-HPA057648)
Atlas Antibodies
- Catalog No.:
- ATL-HPA057648-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CDK2AP1
Alternative Gene Name: doc-1, DOC1, DORC1, p12DOC-1, ST19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029394: 100%, ENSRNOG00000001070: 100%
Entrez Gene ID: 8099
Uniprot ID: O14519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEI |
| Gene Sequence | ATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEI |
| Gene ID - Mouse | ENSMUSG00000029394 |
| Gene ID - Rat | ENSRNOG00000001070 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDK2AP1 pAb (ATL-HPA057648) | |
| Datasheet | Anti CDK2AP1 pAb (ATL-HPA057648) Datasheet (External Link) |
| Vendor Page | Anti CDK2AP1 pAb (ATL-HPA057648) at Atlas Antibodies |
| Documents & Links for Anti CDK2AP1 pAb (ATL-HPA057648) | |
| Datasheet | Anti CDK2AP1 pAb (ATL-HPA057648) Datasheet (External Link) |
| Vendor Page | Anti CDK2AP1 pAb (ATL-HPA057648) |