Anti CDK2AP1 pAb (ATL-HPA057648)

Atlas Antibodies

Catalog No.: ATL-HPA057648-25

Protein Description: cyclin-dependent kinase 2 associated protein 1
Gene Name: CDK2AP1
Alternative Gene Name: doc-1, DOC1, DORC1, p12DOC-1, ST19
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029394: 100%, ENSRNOG00000001070: 100%
Entrez Gene ID: 8099
Uniprot ID: O14519
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEI
• Gene Sequence: ATSSQYRQLLSDYGPPSLGYTQGTGNSQVPQSKYAELLAIIEELGKEI
• Gene ID - Mouse: ENSMUSG00000029394
• Gene ID - Rat: ENSRNOG00000001070
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.