Anti CDK20 pAb (ATL-HPA027379 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA027379-25

• 
• 

Protein Description: cyclin-dependent kinase 20
Gene Name: CDK20
Alternative Gene Name: CCRK, p42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021483: 95%, ENSRNOG00000017991: 94%
Entrez Gene ID: 23552
Uniprot ID: Q8IZL9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILE
• Gene Sequence: LLHQYFFTAPLPAHPSELPIPQRLGGPAPKAHPGPPHIHDFHVDRPLEESLLNPELIRPFILE
• Gene ID - Mouse: ENSMUSG00000021483
• Gene ID - Rat: ENSRNOG00000017991
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.