Anti CDK2 pAb (ATL-HPA066915)

Atlas Antibodies

Catalog No.:
ATL-HPA066915-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: cyclin-dependent kinase 2
Gene Name: CDK2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025358: 100%, ENSRNOG00000006469: 100%
Entrez Gene ID: 1017
Uniprot ID: P24941
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRIS
Gene Sequence PSFPKWARQDFSKVVPPLDEDGRSLLSQMLHYDPNKRIS
Gene ID - Mouse ENSMUSG00000025358
Gene ID - Rat ENSRNOG00000006469
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDK2 pAb (ATL-HPA066915)
Datasheet Anti CDK2 pAb (ATL-HPA066915) Datasheet (External Link)
Vendor Page Anti CDK2 pAb (ATL-HPA066915) at Atlas Antibodies

Documents & Links for Anti CDK2 pAb (ATL-HPA066915)
Datasheet Anti CDK2 pAb (ATL-HPA066915) Datasheet (External Link)
Vendor Page Anti CDK2 pAb (ATL-HPA066915)