Anti CDK17 pAb (ATL-HPA015325)

Atlas Antibodies

SKU:
ATL-HPA015325-25
  • Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neuropil.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & cytosol.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cyclin-dependent kinase 17
Gene Name: CDK17
Alternative Gene Name: PCTAIRE2, PCTK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020015: 98%, ENSRNOG00000004148: 99%
Entrez Gene ID: 5128
Uniprot ID: Q00537
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRI
Gene Sequence RRLSLTLRGSQTIDESLSELAEQMTIEENSSKDNEPIVKNGRPPTSHSMHSFLHQYTGSFKKPPLRRPHSVIGGSLGSFMAMPRNGSRLDIVHENLKMGSDGESDQASGTSSDEVQSPTGVCLRNRI
Gene ID - Mouse ENSMUSG00000020015
Gene ID - Rat ENSRNOG00000004148
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDK17 pAb (ATL-HPA015325)
Datasheet Anti CDK17 pAb (ATL-HPA015325) Datasheet (External Link)
Vendor Page Anti CDK17 pAb (ATL-HPA015325) at Atlas Antibodies

Documents & Links for Anti CDK17 pAb (ATL-HPA015325)
Datasheet Anti CDK17 pAb (ATL-HPA015325) Datasheet (External Link)
Vendor Page Anti CDK17 pAb (ATL-HPA015325)