Anti CDK16 pAb (ATL-HPA001366)

Atlas Antibodies

Catalog No.:
ATL-HPA001366-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cyclin-dependent kinase 16
Gene Name: CDK16
Alternative Gene Name: FLJ16665, PCTAIRE, PCTAIRE1, PCTGAIRE, PCTK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031065: 96%, ENSRNOG00000008578: 96%
Entrez Gene ID: 5127
Uniprot ID: Q00536
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIVHEDLKMGSDGESDQASATSSDEVQSPVRVRMRNHPPRKISTEDINKRLSLPAD
Gene Sequence MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIVHEDLKMGSDGESDQASATSSDEVQSPVRVRMRNHPPRKISTEDINKRLSLPAD
Gene ID - Mouse ENSMUSG00000031065
Gene ID - Rat ENSRNOG00000008578
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDK16 pAb (ATL-HPA001366)
Datasheet Anti CDK16 pAb (ATL-HPA001366) Datasheet (External Link)
Vendor Page Anti CDK16 pAb (ATL-HPA001366) at Atlas Antibodies

Documents & Links for Anti CDK16 pAb (ATL-HPA001366)
Datasheet Anti CDK16 pAb (ATL-HPA001366) Datasheet (External Link)
Vendor Page Anti CDK16 pAb (ATL-HPA001366)
Citations for Anti CDK16 pAb (ATL-HPA001366) – 8 Found
Yanagi, Teruki; Krajewska, Maryla; Matsuzawa, Shu-ichi; Reed, John C. PCTAIRE1 phosphorylates p27 and regulates mitosis in cancer cells. Cancer Research. 2014;74(20):5795-807.  PubMed
Yanagi, Teruki; Tachikawa, Kiyoshi; Wilkie-Grantham, Rachel; Hishiki, Asami; Nagai, Ko; Toyonaga, Ellen; Chivukula, Pad; Matsuzawa, Shu-Ichi. Lipid Nanoparticle-mediated siRNA Transfer Against PCTAIRE1/PCTK1/Cdk16 Inhibits In Vivo Cancer Growth. Molecular Therapy. Nucleic Acids. 2016;5(6):e327.  PubMed
Dixon-Clarke, Sarah E; Shehata, Saifeldin N; Krojer, Tobias; Sharpe, Timothy D; von Delft, Frank; Sakamoto, Kei; Bullock, Alex N. Structure and inhibitor specificity of the PCTAIRE-family kinase CDK16. The Biochemical Journal. 2017;474(5):699-713.  PubMed
Li, Xiao; Li, Jinpeng; Xu, Liming; Wei, Wei; Cheng, Anyi; Zhang, Lingxian; Zhang, Mengna; Wu, Gaosong; Cai, Cheguo. CDK16 promotes the progression and metastasis of triple-negative breast cancer by phosphorylating PRC1. Journal Of Experimental & Clinical Cancer Research : Cr. 2022;41(1):149.  PubMed
Yanagi, Teruki; Reed, John C; Matsuzawa, Shu-Ichi. PCTAIRE1 regulates p27 stability, apoptosis and tumor growth in malignant melanoma. Oncoscience. 1(10):624-33.  PubMed
Yanagi, Teruki; Shi, Ranxin; Aza-Blanc, Pedro; Reed, John C; Matsuzawa, Shu-ichi. PCTAIRE1-knockdown sensitizes cancer cells to TNF family cytokines. Plos One. 10(3):e0119404.  PubMed
Dohmen, Marc; Krieg, Sarah; Agalaridis, Georgios; Zhu, Xiaoqing; Shehata, Saifeldin N; Pfeiffenberger, Elisabeth; Amelang, Jan; Bütepage, Mareike; Buerova, Elena; Pfaff, Carolina M; Chanda, Dipanjan; Geley, Stephan; Preisinger, Christian; Sakamoto, Kei; Lüscher, Bernhard; Neumann, Dietbert; Vervoorts, Jörg. AMPK-dependent activation of the Cyclin Y/CDK16 complex controls autophagy. Nature Communications. 2020;11(1):1032.  PubMed
Wu, Chien-Ting; Lidsky, Peter V; Xiao, Yinghong; Cheng, Ran; Lee, Ivan T; Nakayama, Tsuguhisa; Jiang, Sizun; He, Wei; Demeter, Janos; Knight, Miguel G; Turn, Rachel E; Rojas-Hernandez, Laura S; Ye, Chengjin; Chiem, Kevin; Shon, Judy; Martinez-Sobrido, Luis; Bertozzi, Carolyn R; Nolan, Garry P; Nayak, Jayakar V; Milla, Carlos; Andino, Raul; Jackson, Peter K. SARS-CoV-2 replication in airway epithelia requires motile cilia and microvillar reprogramming. Cell. 2023;186(1):112-130.e20.  PubMed