Anti CDK15 pAb (ATL-HPA015786)

Atlas Antibodies

SKU: ATL-HPA015786-25

• 
• 

Protein Description: cyclin-dependent kinase 15
Gene Name: CDK15
Alternative Gene Name: ALS2CR7, PFTAIRE2, PFTK2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026023: 85%, ENSRNOG00000022899: 86%
Entrez Gene ID: 65061
Uniprot ID: Q96Q40
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PRSLHVVWNRLGRVPEAEDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQLPDEESLFTVSGVRLKPEMCDLLASYQKGHHPA
• Gene Sequence: PRSLHVVWNRLGRVPEAEDLASQMLKGFPRDRVSAQEALVHDYFSALPSQLYQLPDEESLFTVSGVRLKPEMCDLLASYQKGHHPA
• Gene ID - Mouse: ENSMUSG00000026023
• Gene ID - Rat: ENSRNOG00000022899
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.