Anti CDK14 pAb (ATL-HPA015267)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015267-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CDK14
Alternative Gene Name: PFTAIRE1, PFTK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028926: 96%, ENSRNOG00000006000: 23%
Entrez Gene ID: 5218
Uniprot ID: O94921
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNG |
| Gene Sequence | DDTTFDEICVTKMSTRNCQGMDSVIKPLDTIPEDKKVRVQRTQSTFDPFEKPANQVKRVHSENNACINFKTSSTGKESPKVRRHSSPSSPTSPKFGKADSYEKLEKLGEGSYATVYKGKSKVNG |
| Gene ID - Mouse | ENSMUSG00000028926 |
| Gene ID - Rat | ENSRNOG00000006000 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDK14 pAb (ATL-HPA015267) | |
| Datasheet | Anti CDK14 pAb (ATL-HPA015267) Datasheet (External Link) |
| Vendor Page | Anti CDK14 pAb (ATL-HPA015267) at Atlas Antibodies |
| Documents & Links for Anti CDK14 pAb (ATL-HPA015267) | |
| Datasheet | Anti CDK14 pAb (ATL-HPA015267) Datasheet (External Link) |
| Vendor Page | Anti CDK14 pAb (ATL-HPA015267) |
| Citations for Anti CDK14 pAb (ATL-HPA015267) – 3 Found |
| Ji, Quanbo; Xu, Xiaojie; Li, Ling; Goodman, Stuart B; Bi, Wenzhi; Xu, Meng; Xu, Yameng; Fan, Zhongyi; Maloney, William J; Ye, Qinong; Wang, Yan. miR-216a inhibits osteosarcoma cell proliferation, invasion and metastasis by targeting CDK14. Cell Death & Disease. 2017;8(10):e3103. PubMed |
| Miyagaki, H; Yamasaki, M; Miyata, H; Takahashi, T; Kurokawa, Y; Nakajima, K; Takiguchi, S; Fujiwara, Y; Ishii, H; Tanaka, F; Mori, M; Doki, Y. Overexpression of PFTK1 predicts resistance to chemotherapy in patients with oesophageal squamous cell carcinoma. British Journal Of Cancer. 2012;106(5):947-54. PubMed |
| Endo, Yutaka; Fujimoto, Mao; Ito, Nanako; Takahashi, Yoriko; Kitago, Minoru; Gotoh, Masahiro; Hiraoka, Nobuyoshi; Yoshida, Teruhiko; Kitagawa, Yuko; Kanai, Yae; Arai, Eri. Clinicopathological impacts of DNA methylation alterations on pancreatic ductal adenocarcinoma: prediction of early recurrence based on genome-wide DNA methylation profiling. Journal Of Cancer Research And Clinical Oncology. 2021;147(5):1341-1354. PubMed |