Anti CDK10 pAb (ATL-HPA007451)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007451-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CDK10
Alternative Gene Name: PISSLRE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033862: 99%, ENSRNOG00000016088: 98%
Entrez Gene ID: 8558
Uniprot ID: Q15131
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQVKCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVK |
Gene Sequence | RMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQVKCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVK |
Gene ID - Mouse | ENSMUSG00000033862 |
Gene ID - Rat | ENSRNOG00000016088 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDK10 pAb (ATL-HPA007451) | |
Datasheet | Anti CDK10 pAb (ATL-HPA007451) Datasheet (External Link) |
Vendor Page | Anti CDK10 pAb (ATL-HPA007451) at Atlas Antibodies |
Documents & Links for Anti CDK10 pAb (ATL-HPA007451) | |
Datasheet | Anti CDK10 pAb (ATL-HPA007451) Datasheet (External Link) |
Vendor Page | Anti CDK10 pAb (ATL-HPA007451) |