Anti CDK10 pAb (ATL-HPA007451)

Atlas Antibodies

Catalog No.:
ATL-HPA007451-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: cyclin dependent kinase 10
Gene Name: CDK10
Alternative Gene Name: PISSLRE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033862: 99%, ENSRNOG00000016088: 98%
Entrez Gene ID: 8558
Uniprot ID: Q15131
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQVKCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVK
Gene Sequence RMDKEKDGIPISSLREITLLLRLRHPNIVELKEVVVGNHLESIFLVMGYCEQDLASLLENMPTPFSEAQVKCIVLQVLRGLQYLHRNFIIHRDLKVSNLLMTDKGCVKTADFGLARAYGVPVK
Gene ID - Mouse ENSMUSG00000033862
Gene ID - Rat ENSRNOG00000016088
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDK10 pAb (ATL-HPA007451)
Datasheet Anti CDK10 pAb (ATL-HPA007451) Datasheet (External Link)
Vendor Page Anti CDK10 pAb (ATL-HPA007451) at Atlas Antibodies

Documents & Links for Anti CDK10 pAb (ATL-HPA007451)
Datasheet Anti CDK10 pAb (ATL-HPA007451) Datasheet (External Link)
Vendor Page Anti CDK10 pAb (ATL-HPA007451)