Anti CDK1 pAb (ATL-HPA003387 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA003387-25
- Shipping:
- Calculated at Checkout
$351.00
Gene Name: CDK1
Alternative Gene Name: CDC2, CDC28A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019942: 98%, ENSRNOG00000000632: 98%
Entrez Gene ID: 983
Uniprot ID: P06493
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
| Gene Sequence | LGSARYSTPVDIWSIGTIFAELATKKPLFHGDSEIDQLFRIFRALGTPNNEVWPEVESLQDYKNTFPKWKPGSLASHVKNLDENGLDLLSKMLIYDPAKRISGKMALNHPYFNDLDNQIKKM |
| Gene ID - Mouse | ENSMUSG00000019942 |
| Gene ID - Rat | ENSRNOG00000000632 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDK1 pAb (ATL-HPA003387 w/enhanced validation) | |
| Datasheet | Anti CDK1 pAb (ATL-HPA003387 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDK1 pAb (ATL-HPA003387 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CDK1 pAb (ATL-HPA003387 w/enhanced validation) | |
| Datasheet | Anti CDK1 pAb (ATL-HPA003387 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDK1 pAb (ATL-HPA003387 w/enhanced validation) |
| Citations for Anti CDK1 pAb (ATL-HPA003387 w/enhanced validation) – 10 Found |
| Xu, Guilian; Pattamatta, Amrutha; Hildago, Ryan; Pace, Michael C; Brown, Hilda; Borchelt, David R. Vulnerability of newly synthesized proteins to proteostasis stress. Journal Of Cell Science. 2016;129(9):1892-901. PubMed |
| Goto, Yusuke; Kurozumi, Akira; Arai, Takayuki; Nohata, Nijiro; Kojima, Satoko; Okato, Atsushi; Kato, Mayuko; Yamazaki, Kazuto; Ishida, Yasuo; Naya, Yukio; Ichikawa, Tomohiko; Seki, Naohiko. Impact of novel miR-145-3p regulatory networks on survival in patients with castration-resistant prostate cancer. British Journal Of Cancer. 2017;117(3):409-420. PubMed |
| Marlier, Quentin; Jibassia, Florian; Verteneuil, Sébastien; Linden, Jérôme; Kaldis, Philipp; Meijer, Laurent; Nguyen, Laurent; Vandenbosch, Renaud; Malgrange, Brigitte. Genetic and pharmacological inhibition of Cdk1 provides neuroprotection towards ischemic neuronal death. Cell Death Discovery. 4( 29581894):43. PubMed |
| Sousa, Mirta M L; Zub, Kamila Anna; Aas, Per Arne; Hanssen-Bauer, Audun; Demirovic, Aida; Sarno, Antonio; Tian, Erming; Liabakk, Nina B; Slupphaug, Geir. An inverse switch in DNA base excision and strand break repair contributes to melphalan resistance in multiple myeloma cells. Plos One. 8(2):e55493. PubMed |
| Lukinavičius, Gražvydas; Lavogina, Darja; Gönczy, Pierre; Johnsson, Kai. Commercial Cdk1 antibodies recognize the centrosomal protein Cep152. Biotechniques. 2013;55(3):111-4. PubMed |
| Müllers, Erik; Silva Cascales, Helena; Burdova, Kamila; Macurek, Libor; Lindqvist, Arne. Residual Cdk1/2 activity after DNA damage promotes senescence. Aging Cell. 2017;16(3):575-584. PubMed |
| Zheng, Hai-Ping; Huang, Zhi-Guang; He, Rong-Quan; Lu, Hui-Ping; Dang, Yi-Wu; Lin, Peng; Wen, Dong-Yue; Qin, Yong-Ying; Luo, Bin; Li, Xiao-Jiao; Mo, Wei-Jia; Yang, Hong; He, Yun; Chen, Gang. Integrated assessment of CDK1 upregulation in thyroid cancer. American Journal Of Translational Research. 11(12):7233-7254. PubMed |
| Yasukawa, Mami; Ando, Yoshinari; Yamashita, Taro; Matsuda, Yoko; Shoji, Shisako; Morioka, Masaki Suimye; Kawaji, Hideya; Shiozawa, Kumiko; Machitani, Mitsuhiro; Abe, Takaya; Yamada, Shinji; Kaneko, Mika K; Kato, Yukinari; Furuta, Yasuhide; Kondo, Tadashi; Shirouzu, Mikako; Hayashizaki, Yoshihide; Kaneko, Shuichi; Masutomi, Kenkichi. CDK1 dependent phosphorylation of hTERT contributes to cancer progression. Nature Communications. 2020;11(1):1557. PubMed |
| Shen, Peilin; He, Xuejun; Lan, Lin; Hong, Yingkai; Lin, Mingen. Identification of cell division cycle 20 as a candidate biomarker and potential therapeutic target in bladder cancer using bioinformatics analysis. Bioscience Reports. 2020;40(7) PubMed |
| Suski, Jan M; Ratnayeke, Nalin; Braun, Marcin; Zhang, Tian; Strmiska, Vladislav; Michowski, Wojciech; Can, Geylani; Simoneau, Antoine; Snioch, Konrad; Cup, Mikolaj; Sullivan, Caitlin M; Wu, Xiaoji; Nowacka, Joanna; Branigan, Timothy B; Pack, Lindsey R; DeCaprio, James A; Geng, Yan; Zou, Lee; Gygi, Steven P; Walter, Johannes C; Meyer, Tobias; Sicinski, Piotr. CDC7-independent G1/S transition revealed by targeted protein degradation. Nature. 2022;605(7909):357-365. PubMed |