Anti CDHR3 pAb (ATL-HPA011218)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011218-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CDHR3
Alternative Gene Name: CDH28, FLJ23834, FLJ44366
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047810: 27%, ENSRNOG00000009872: 27%
Entrez Gene ID: 222256
Uniprot ID: Q6ZTQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK |
| Gene Sequence | LTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK |
| Gene ID - Mouse | ENSMUSG00000047810 |
| Gene ID - Rat | ENSRNOG00000009872 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDHR3 pAb (ATL-HPA011218) | |
| Datasheet | Anti CDHR3 pAb (ATL-HPA011218) Datasheet (External Link) |
| Vendor Page | Anti CDHR3 pAb (ATL-HPA011218) at Atlas Antibodies |
| Documents & Links for Anti CDHR3 pAb (ATL-HPA011218) | |
| Datasheet | Anti CDHR3 pAb (ATL-HPA011218) Datasheet (External Link) |
| Vendor Page | Anti CDHR3 pAb (ATL-HPA011218) |
| Citations for Anti CDHR3 pAb (ATL-HPA011218) – 4 Found |
| Bonser, Luke R; Koh, Kyung Duk; Johansson, Kristina; Choksi, Semil P; Cheng, Dan; Liu, Leqian; Sun, Dingyuan I; Zlock, Lorna T; Eckalbar, Walter L; Finkbeiner, Walter E; Erle, David J. Flow-Cytometric Analysis and Purification of Airway Epithelial-Cell Subsets. American Journal Of Respiratory Cell And Molecular Biology. 2021;64(3):308-317. PubMed |
| Bochkov, Yury A; Watters, Kelly; Ashraf, Shamaila; Griggs, Theodor F; Devries, Mark K; Jackson, Daniel J; Palmenberg, Ann C; Gern, James E. Cadherin-related family member 3, a childhood asthma susceptibility gene product, mediates rhinovirus C binding and replication. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2015;112(17):5485-90. PubMed |
| Griggs, Theodor F; Bochkov, Yury A; Basnet, Sarmila; Pasic, Thomas R; Brockman-Schneider, Rebecca A; Palmenberg, Ann C; Gern, James E. Rhinovirus C targets ciliated airway epithelial cells. Respiratory Research. 2017;18(1):84. PubMed |
| Watters, Kelly; Palmenberg, Ann C. CDHR3 extracellular domains EC1-3 mediate rhinovirus C interaction with cells and as recombinant derivatives, are inhibitory to virus infection. Plos Pathogens. 2018;14(12):e1007477. PubMed |