Anti CDHR3 pAb (ATL-HPA011218)

Atlas Antibodies

Catalog No.:
ATL-HPA011218-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cadherin-related family member 3
Gene Name: CDHR3
Alternative Gene Name: CDH28, FLJ23834, FLJ44366
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047810: 27%, ENSRNOG00000009872: 27%
Entrez Gene ID: 222256
Uniprot ID: Q6ZTQ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK
Gene Sequence LTQMPKWKESSHQGAAPRRVTAGEGMGSLRSANWEEDELSGKAWAEDAGLGSRNEGGKLGNPKNRNPAFMNRAYPKPHPGK
Gene ID - Mouse ENSMUSG00000047810
Gene ID - Rat ENSRNOG00000009872
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDHR3 pAb (ATL-HPA011218)
Datasheet Anti CDHR3 pAb (ATL-HPA011218) Datasheet (External Link)
Vendor Page Anti CDHR3 pAb (ATL-HPA011218) at Atlas Antibodies

Documents & Links for Anti CDHR3 pAb (ATL-HPA011218)
Datasheet Anti CDHR3 pAb (ATL-HPA011218) Datasheet (External Link)
Vendor Page Anti CDHR3 pAb (ATL-HPA011218)
Citations for Anti CDHR3 pAb (ATL-HPA011218) – 4 Found
Bonser, Luke R; Koh, Kyung Duk; Johansson, Kristina; Choksi, Semil P; Cheng, Dan; Liu, Leqian; Sun, Dingyuan I; Zlock, Lorna T; Eckalbar, Walter L; Finkbeiner, Walter E; Erle, David J. Flow-Cytometric Analysis and Purification of Airway Epithelial-Cell Subsets. American Journal Of Respiratory Cell And Molecular Biology. 2021;64(3):308-317.  PubMed
Bochkov, Yury A; Watters, Kelly; Ashraf, Shamaila; Griggs, Theodor F; Devries, Mark K; Jackson, Daniel J; Palmenberg, Ann C; Gern, James E. Cadherin-related family member 3, a childhood asthma susceptibility gene product, mediates rhinovirus C binding and replication. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2015;112(17):5485-90.  PubMed
Griggs, Theodor F; Bochkov, Yury A; Basnet, Sarmila; Pasic, Thomas R; Brockman-Schneider, Rebecca A; Palmenberg, Ann C; Gern, James E. Rhinovirus C targets ciliated airway epithelial cells. Respiratory Research. 2017;18(1):84.  PubMed
Watters, Kelly; Palmenberg, Ann C. CDHR3 extracellular domains EC1-3 mediate rhinovirus C interaction with cells and as recombinant derivatives, are inhibitory to virus infection. Plos Pathogens. 2018;14(12):e1007477.  PubMed