Anti CDHR2 pAb (ATL-HPA012569)

Atlas Antibodies

SKU: ATL-HPA012569-25

• 

Protein Description: cadherin-related family member 2
Gene Name: CDHR2
Alternative Gene Name: FLJ20124, FLJ20383, PC-LKC, PCDH24, PCLKC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034918: 74%, ENSRNOG00000017917: 72%
Entrez Gene ID: 54825
Uniprot ID: Q9BYE9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDSTLQGTYQVTVQARDRPSLGPFLEATTTLNLFTVDQSYRSRLQFSTPKEEVGANRQAINAALTQATRTTVYIVDIQDIDSAARARPHSYLDAYFVFPNGSALTLDELSVMIRNDQDSLTQLLQLGLVVLGSQESQESDLSKQLISV
• Gene Sequence: LDSTLQGTYQVTVQARDRPSLGPFLEATTTLNLFTVDQSYRSRLQFSTPKEEVGANRQAINAALTQATRTTVYIVDIQDIDSAARARPHSYLDAYFVFPNGSALTLDELSVMIRNDQDSLTQLLQLGLVVLGSQESQESDLSKQLISV
• Gene ID - Mouse: ENSMUSG00000034918
• Gene ID - Rat: ENSRNOG00000017917
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDHR2 pAb (ATL-HPA012569) – 5 Found

Li, Jianchao; He, Yunyun; Weck, Meredith L; Lu, Qing; Tyska, Matthew J; Zhang, Mingjie. Structure of Myo7b/USH1C complex suggests a general PDZ domain binding mode by MyTH4-FERM myosins. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2017;114(19):E3776-E3785. 

Pinette, Julia A; Mao, Suli; Millis, Bryan A; Krystofiak, Evan S; Faust, James J; Tyska, Matthew J. Brush border protocadherin CDHR2 promotes the elongation and maximized packing of microvilli in vivo. Molecular Biology Of The Cell. 2019;30(1):108-118. 

Graves, Maura J; Matoo, Samaneh; Choi, Myoung Soo; Storad, Zachary A; El Sheikh Idris, Rawnag A; Pickles, Brooke K; Acharya, Prashun; Shinder, Paula E; Arvay, Taylen O; Crawley, Scott W. A cryptic sequence targets the adhesion complex scaffold ANKS4B to apical microvilli to promote enterocyte brush border assembly. The Journal Of Biological Chemistry. 2020;295(36):12588-12604. 

McConnell, Russell E; Benesh, Andrew E; Mao, Suli; Tabb, David L; Tyska, Matthew J. Proteomic analysis of the enterocyte brush border. American Journal Of Physiology. Gastrointestinal And Liver Physiology. 2011;300(5):G914-26. 

Weck, Meredith L; Crawley, Scott W; Tyska, Matthew J. A heterologous in-cell assay for investigating intermicrovillar adhesion complex interactions reveals a novel protrusion length-matching mechanism. The Journal Of Biological Chemistry. 2020;295(48):16191-16206.