Anti CDHR1 pAb (ATL-HPA036819)

Atlas Antibodies

Catalog No.:
ATL-HPA036819-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cadherin-related family member 1
Gene Name: CDHR1
Alternative Gene Name: CORD15, KIAA1775, PCDH21, RP65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021803: 84%, ENSRNOG00000013330: 86%
Entrez Gene ID: 92211
Uniprot ID: Q96JP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPYYGYVYEDTLPGSEVLKVVAMDGDRGKPNRILYSLVNGNDGAFEINETSGAISITQSPAQLQREVYELHVQVTE
Gene Sequence TPYYGYVYEDTLPGSEVLKVVAMDGDRGKPNRILYSLVNGNDGAFEINETSGAISITQSPAQLQREVYELHVQVTE
Gene ID - Mouse ENSMUSG00000021803
Gene ID - Rat ENSRNOG00000013330
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDHR1 pAb (ATL-HPA036819)
Datasheet Anti CDHR1 pAb (ATL-HPA036819) Datasheet (External Link)
Vendor Page Anti CDHR1 pAb (ATL-HPA036819) at Atlas Antibodies

Documents & Links for Anti CDHR1 pAb (ATL-HPA036819)
Datasheet Anti CDHR1 pAb (ATL-HPA036819) Datasheet (External Link)
Vendor Page Anti CDHR1 pAb (ATL-HPA036819)