Anti CDHR1 pAb (ATL-HPA036819)

Atlas Antibodies

SKU: ATL-HPA036819-25

• 

Protein Description: cadherin-related family member 1
Gene Name: CDHR1
Alternative Gene Name: CORD15, KIAA1775, PCDH21, RP65
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021803: 84%, ENSRNOG00000013330: 86%
Entrez Gene ID: 92211
Uniprot ID: Q96JP9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TPYYGYVYEDTLPGSEVLKVVAMDGDRGKPNRILYSLVNGNDGAFEINETSGAISITQSPAQLQREVYELHVQVTE
• Gene Sequence: TPYYGYVYEDTLPGSEVLKVVAMDGDRGKPNRILYSLVNGNDGAFEINETSGAISITQSPAQLQREVYELHVQVTE
• Gene ID - Mouse: ENSMUSG00000021803
• Gene ID - Rat: ENSRNOG00000013330
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.