Anti CDH7 pAb (ATL-HPA061419)

Atlas Antibodies

Catalog No.:
ATL-HPA061419-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cadherin 7, type 2
Gene Name: CDH7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026312: 93%, ENSRNOG00000032490: 95%
Entrez Gene ID: 1005
Uniprot ID: Q9ULB5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FDMAALRNLNVIRDTKTRRDVTPEIQFLSRPAFKSIPDNVIFREFIWERLKEADVDP
Gene Sequence FDMAALRNLNVIRDTKTRRDVTPEIQFLSRPAFKSIPDNVIFREFIWERLKEADVDP
Gene ID - Mouse ENSMUSG00000026312
Gene ID - Rat ENSRNOG00000032490
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDH7 pAb (ATL-HPA061419)
Datasheet Anti CDH7 pAb (ATL-HPA061419) Datasheet (External Link)
Vendor Page Anti CDH7 pAb (ATL-HPA061419) at Atlas Antibodies

Documents & Links for Anti CDH7 pAb (ATL-HPA061419)
Datasheet Anti CDH7 pAb (ATL-HPA061419) Datasheet (External Link)
Vendor Page Anti CDH7 pAb (ATL-HPA061419)