Anti CDH6 pAb (ATL-HPA007456)

Atlas Antibodies

Catalog No.:
ATL-HPA007456-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cadherin 6, type 2, K-cadherin (fetal kidney)
Gene Name: CDH6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039385: 95%, ENSRNOG00000013535: 82%
Entrez Gene ID: 1004
Uniprot ID: P55285
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ADVGENAEIEYSITDGEGLDMFDVITDQETQEGIITVKKLLDFEKKKVYTLKVEASNPYVEPRFLYLGPFKDSATVRIVVEDVDEPPVFSKLAYILQIREDAQINTTIGSVTAQDPDAARNP
Gene Sequence ADVGENAEIEYSITDGEGLDMFDVITDQETQEGIITVKKLLDFEKKKVYTLKVEASNPYVEPRFLYLGPFKDSATVRIVVEDVDEPPVFSKLAYILQIREDAQINTTIGSVTAQDPDAARNP
Gene ID - Mouse ENSMUSG00000039385
Gene ID - Rat ENSRNOG00000013535
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDH6 pAb (ATL-HPA007456)
Datasheet Anti CDH6 pAb (ATL-HPA007456) Datasheet (External Link)
Vendor Page Anti CDH6 pAb (ATL-HPA007456) at Atlas Antibodies

Documents & Links for Anti CDH6 pAb (ATL-HPA007456)
Datasheet Anti CDH6 pAb (ATL-HPA007456) Datasheet (External Link)
Vendor Page Anti CDH6 pAb (ATL-HPA007456)
Citations for Anti CDH6 pAb (ATL-HPA007456) – 3 Found
Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17.  PubMed
Zhou, Wei; Santos, Leilani; Dimitriadis, Evdokia. Characterization of the role for cadherin 6 in the regulation of human endometrial receptivity. Reproductive Biology And Endocrinology : Rb&E. 2020;18(1):66.  PubMed
Yamanaka, Shuichiro; Matsui, Kenji; Fujimoto, Toshinari; Takamura, Tsuyoshi; Saito, Yatsumu; Matsumoto, Naoto; Tajiri, Susumu; Matsumoto, Kei; Yokoo, Takashi. In vivo regeneration of neo-nephrons in rodents by renal progenitor cell transplantation. Star Protocols. 2021;2(1):100314.  PubMed