Anti CDH6 pAb (ATL-HPA007456)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007456-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CDH6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039385: 95%, ENSRNOG00000013535: 82%
Entrez Gene ID: 1004
Uniprot ID: P55285
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ADVGENAEIEYSITDGEGLDMFDVITDQETQEGIITVKKLLDFEKKKVYTLKVEASNPYVEPRFLYLGPFKDSATVRIVVEDVDEPPVFSKLAYILQIREDAQINTTIGSVTAQDPDAARNP |
| Gene Sequence | ADVGENAEIEYSITDGEGLDMFDVITDQETQEGIITVKKLLDFEKKKVYTLKVEASNPYVEPRFLYLGPFKDSATVRIVVEDVDEPPVFSKLAYILQIREDAQINTTIGSVTAQDPDAARNP |
| Gene ID - Mouse | ENSMUSG00000039385 |
| Gene ID - Rat | ENSRNOG00000013535 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDH6 pAb (ATL-HPA007456) | |
| Datasheet | Anti CDH6 pAb (ATL-HPA007456) Datasheet (External Link) |
| Vendor Page | Anti CDH6 pAb (ATL-HPA007456) at Atlas Antibodies |
| Documents & Links for Anti CDH6 pAb (ATL-HPA007456) | |
| Datasheet | Anti CDH6 pAb (ATL-HPA007456) Datasheet (External Link) |
| Vendor Page | Anti CDH6 pAb (ATL-HPA007456) |
| Citations for Anti CDH6 pAb (ATL-HPA007456) – 3 Found |
| Wu, Chih-Ching; Hsu, Chia-Wei; Chen, Chi-De; Yu, Chia-Jung; Chang, Kai-Ping; Tai, Dar-In; Liu, Hao-Ping; Su, Wen-Hui; Chang, Yu-Sun; Yu, Jau-Song. Candidate serological biomarkers for cancer identified from the secretomes of 23 cancer cell lines and the human protein atlas. Molecular & Cellular Proteomics : Mcp. 2010;9(6):1100-17. PubMed |
| Zhou, Wei; Santos, Leilani; Dimitriadis, Evdokia. Characterization of the role for cadherin 6 in the regulation of human endometrial receptivity. Reproductive Biology And Endocrinology : Rb&E. 2020;18(1):66. PubMed |
| Yamanaka, Shuichiro; Matsui, Kenji; Fujimoto, Toshinari; Takamura, Tsuyoshi; Saito, Yatsumu; Matsumoto, Naoto; Tajiri, Susumu; Matsumoto, Kei; Yokoo, Takashi. In vivo regeneration of neo-nephrons in rodents by renal progenitor cell transplantation. Star Protocols. 2021;2(1):100314. PubMed |