Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA007047-25

Protein Description: cadherin 6, type 2, K-cadherin (fetal kidney)
Gene Name: CDH6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039385: 98%, ENSRNOG00000013535: 100%
Entrez Gene ID: 1004
Uniprot ID: P55285
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDRETLLWHNITVIATEINNPKQSSRVPLYIKVLDVNDNAPEFAEFYETFVCEKAKADQLIQTLHAVDKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLP
• Gene Sequence: LDRETLLWHNITVIATEINNPKQSSRVPLYIKVLDVNDNAPEFAEFYETFVCEKAKADQLIQTLHAVDKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLP
• Gene ID - Mouse: ENSMUSG00000039385
• Gene ID - Rat: ENSRNOG00000013535
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) – 4 Found

Marable, Sierra S; Chung, Eunah; Park, Joo-Seop. Hnf4a Is Required for the Development of Cdh6-Expressing Progenitors into Proximal Tubules in the Mouse Kidney. Journal Of The American Society Of Nephrology : Jasn. 2020;31(11):2543-2558. 

Sancisi, Valentina; Gandolfi, Greta; Ragazzi, Moira; Nicoli, Davide; Tamagnini, Ione; Piana, Simonetta; Ciarrocchi, Alessia. Cadherin 6 is a new RUNX2 target in TGF-β signalling pathway. Plos One. 8(9):e75489. 

Takasato, M; Er, P X; Becroft, M; Vanslambrouck, J M; Stanley, E G; Elefanty, A G; Little, M H. Directing human embryonic stem cell differentiation towards a renal lineage generates a self-organizing kidney. Nature Cell Biology. 2014;16(1):118-26. 

Deacon, Patrick; Concodora, Charles W; Chung, Eunah; Park, Joo-Seop. β-catenin regulates the formation of multiple nephron segments in the mouse kidney. Scientific Reports. 2019;9(1):15915.