Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007047-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CDH6
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039385: 98%, ENSRNOG00000013535: 100%
Entrez Gene ID: 1004
Uniprot ID: P55285
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LDRETLLWHNITVIATEINNPKQSSRVPLYIKVLDVNDNAPEFAEFYETFVCEKAKADQLIQTLHAVDKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLP |
Gene Sequence | LDRETLLWHNITVIATEINNPKQSSRVPLYIKVLDVNDNAPEFAEFYETFVCEKAKADQLIQTLHAVDKDDPYSGHQFSFSLAPEAASGSNFTIQDNKDNTAGILTRKNGYNRHEMSTYLLP |
Gene ID - Mouse | ENSMUSG00000039385 |
Gene ID - Rat | ENSRNOG00000013535 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) | |
Datasheet | Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) | |
Datasheet | Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) |
Citations for Anti CDH6 pAb (ATL-HPA007047 w/enhanced validation) – 4 Found |
Marable, Sierra S; Chung, Eunah; Park, Joo-Seop. Hnf4a Is Required for the Development of Cdh6-Expressing Progenitors into Proximal Tubules in the Mouse Kidney. Journal Of The American Society Of Nephrology : Jasn. 2020;31(11):2543-2558. PubMed |
Sancisi, Valentina; Gandolfi, Greta; Ragazzi, Moira; Nicoli, Davide; Tamagnini, Ione; Piana, Simonetta; Ciarrocchi, Alessia. Cadherin 6 is a new RUNX2 target in TGF-β signalling pathway. Plos One. 8(9):e75489. PubMed |
Takasato, M; Er, P X; Becroft, M; Vanslambrouck, J M; Stanley, E G; Elefanty, A G; Little, M H. Directing human embryonic stem cell differentiation towards a renal lineage generates a self-organizing kidney. Nature Cell Biology. 2014;16(1):118-26. PubMed |
Deacon, Patrick; Concodora, Charles W; Chung, Eunah; Park, Joo-Seop. β-catenin regulates the formation of multiple nephron segments in the mouse kidney. Scientific Reports. 2019;9(1):15915. PubMed |