Anti CDH5 pAb (ATL-HPA075875)

Atlas Antibodies

Catalog No.:
ATL-HPA075875-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: cadherin 5
Gene Name: CDH5
Alternative Gene Name: 7B4, CD144
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031871: 69%, ENSRNOG00000013324: 72%
Entrez Gene ID: 1003
Uniprot ID: P33151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETP
Gene Sequence SLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETP
Gene ID - Mouse ENSMUSG00000031871
Gene ID - Rat ENSRNOG00000013324
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDH5 pAb (ATL-HPA075875)
Datasheet Anti CDH5 pAb (ATL-HPA075875) Datasheet (External Link)
Vendor Page Anti CDH5 pAb (ATL-HPA075875) at Atlas Antibodies

Documents & Links for Anti CDH5 pAb (ATL-HPA075875)
Datasheet Anti CDH5 pAb (ATL-HPA075875) Datasheet (External Link)
Vendor Page Anti CDH5 pAb (ATL-HPA075875)