Anti CDH5 pAb (ATL-HPA075875)
Atlas Antibodies
- Catalog No.:
- ATL-HPA075875-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: CDH5
Alternative Gene Name: 7B4, CD144
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031871: 69%, ENSRNOG00000013324: 72%
Entrez Gene ID: 1003
Uniprot ID: P33151
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETP |
| Gene Sequence | SLPHHVGKIKSSVSRKNAKYLLKGEYVGKVFRVDAETGDVFAIERLDRENISEYHLTAVIVDKDTGENLETP |
| Gene ID - Mouse | ENSMUSG00000031871 |
| Gene ID - Rat | ENSRNOG00000013324 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDH5 pAb (ATL-HPA075875) | |
| Datasheet | Anti CDH5 pAb (ATL-HPA075875) Datasheet (External Link) |
| Vendor Page | Anti CDH5 pAb (ATL-HPA075875) at Atlas Antibodies |
| Documents & Links for Anti CDH5 pAb (ATL-HPA075875) | |
| Datasheet | Anti CDH5 pAb (ATL-HPA075875) Datasheet (External Link) |
| Vendor Page | Anti CDH5 pAb (ATL-HPA075875) |