Anti CDH3 pAb (ATL-HPA001767 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA001767-25

• 
• 

Protein Description: cadherin 3, type 1, P-cadherin (placental)
Gene Name: CDH3
Alternative Gene Name: CDHP, PCAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000061048: 90%, ENSRNOG00000020129: 90%
Entrez Gene ID: 1001
Uniprot ID: P22223
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILDANDNAPMFDPQKYEAHVPENAVGHEVQRLTVTDLDAPNSPAWRATYLIMGGDDGDHFTITTHPE
• Gene Sequence: YNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQATDMDGDGSTTTAVAVVEILDANDNAPMFDPQKYEAHVPENAVGHEVQRLTVTDLDAPNSPAWRATYLIMGGDDGDHFTITTHPE
• Gene ID - Mouse: ENSMUSG00000061048
• Gene ID - Rat: ENSRNOG00000020129
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDH3 pAb (ATL-HPA001767 w/enhanced validation) – 2 Found

Belulescu, Iulia Cristiana; Mărgăritescu, Claudiu; Dumitrescu, Cristiana Iulia; Munteanu, Maria Cristina; Mărgăritescu, Otilia Clara. Immunophenotypical alterations with impact on the epithelial-mesenchymal transition (EMT) process in salivary gland adenoid cystic carcinomas. Romanian Journal Of Morphology And Embryology = Revue Roumaine De Morphologie Et Embryologie. 61(1):175-187. 

Lewczuk, Łukasz; Pryczynicz, Anna; Guzińska-Ustymowicz, Katarzyna. Expression level of E-, N- and P-cadherin proteins in endometrial cancer. Oncology Letters. 2021;21(4):261.