Anti CDH26 pAb (ATL-HPA015722)

Atlas Antibodies

Catalog No.:
ATL-HPA015722-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cadherin 26
Gene Name: CDH26
Alternative Gene Name: VR20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039155: 64%, ENSRNOG00000053332: 56%
Entrez Gene ID: 60437
Uniprot ID: Q8IXH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VIIIHAVDDGFPPQTATGTLMLFLSDINDNVPTLRPRSRYMEVCESAVHEPLHIEAEDPDLEPFSDPFTFELDNTWGNAEDTWKLGRNWGQSVELLTLRSLPRGNYLVPLFIGDKQGLSQKQTVHVRICPCASGLTCVELADAEVGL
Gene Sequence VIIIHAVDDGFPPQTATGTLMLFLSDINDNVPTLRPRSRYMEVCESAVHEPLHIEAEDPDLEPFSDPFTFELDNTWGNAEDTWKLGRNWGQSVELLTLRSLPRGNYLVPLFIGDKQGLSQKQTVHVRICPCASGLTCVELADAEVGL
Gene ID - Mouse ENSMUSG00000039155
Gene ID - Rat ENSRNOG00000053332
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDH26 pAb (ATL-HPA015722)
Datasheet Anti CDH26 pAb (ATL-HPA015722) Datasheet (External Link)
Vendor Page Anti CDH26 pAb (ATL-HPA015722) at Atlas Antibodies

Documents & Links for Anti CDH26 pAb (ATL-HPA015722)
Datasheet Anti CDH26 pAb (ATL-HPA015722) Datasheet (External Link)
Vendor Page Anti CDH26 pAb (ATL-HPA015722)
Citations for Anti CDH26 pAb (ATL-HPA015722) – 1 Found
Lachowicz-Scroggins, Marrah E; Gordon, Erin D; Wesolowska-Andersen, Agata; Jackson, Nathan D; MacLeod, Hannah J; Sharp, Louis Z; Sun, Matthew; Seibold, Max A; Fahy, John V. Cadherin-26 (CDH26) regulates airway epithelial cell cytoskeletal structure and polarity. Cell Discovery. 4( 29449961):7.  PubMed