Anti CDH26 pAb (ATL-HPA015722)
Atlas Antibodies
- Catalog No.:
- ATL-HPA015722-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CDH26
Alternative Gene Name: VR20
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039155: 64%, ENSRNOG00000053332: 56%
Entrez Gene ID: 60437
Uniprot ID: Q8IXH8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VIIIHAVDDGFPPQTATGTLMLFLSDINDNVPTLRPRSRYMEVCESAVHEPLHIEAEDPDLEPFSDPFTFELDNTWGNAEDTWKLGRNWGQSVELLTLRSLPRGNYLVPLFIGDKQGLSQKQTVHVRICPCASGLTCVELADAEVGL |
Gene Sequence | VIIIHAVDDGFPPQTATGTLMLFLSDINDNVPTLRPRSRYMEVCESAVHEPLHIEAEDPDLEPFSDPFTFELDNTWGNAEDTWKLGRNWGQSVELLTLRSLPRGNYLVPLFIGDKQGLSQKQTVHVRICPCASGLTCVELADAEVGL |
Gene ID - Mouse | ENSMUSG00000039155 |
Gene ID - Rat | ENSRNOG00000053332 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDH26 pAb (ATL-HPA015722) | |
Datasheet | Anti CDH26 pAb (ATL-HPA015722) Datasheet (External Link) |
Vendor Page | Anti CDH26 pAb (ATL-HPA015722) at Atlas Antibodies |
Documents & Links for Anti CDH26 pAb (ATL-HPA015722) | |
Datasheet | Anti CDH26 pAb (ATL-HPA015722) Datasheet (External Link) |
Vendor Page | Anti CDH26 pAb (ATL-HPA015722) |
Citations for Anti CDH26 pAb (ATL-HPA015722) – 1 Found |
Lachowicz-Scroggins, Marrah E; Gordon, Erin D; Wesolowska-Andersen, Agata; Jackson, Nathan D; MacLeod, Hannah J; Sharp, Louis Z; Sun, Matthew; Seibold, Max A; Fahy, John V. Cadherin-26 (CDH26) regulates airway epithelial cell cytoskeletal structure and polarity. Cell Discovery. 4( 29449961):7. PubMed |