Anti CDH2 pAb (ATL-HPA058574 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA058574-25
Shipping:
Calculated at Checkout
$351.00
Adding to cart… The item has been added
Protein Description: cadherin 2, type 1, N-cadherin (neuronal)
Gene Name: CDH2
Alternative Gene Name: CD325, CDHN, NCAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024304: 99%, ENSRNOG00000015602: 99%
Entrez Gene ID: 1000
Uniprot ID: P19022
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP
Gene Sequence NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP
Gene ID - Mouse ENSMUSG00000024304
Gene ID - Rat ENSRNOG00000015602
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDH2 pAb (ATL-HPA058574 w/enhanced validation)
Datasheet Anti CDH2 pAb (ATL-HPA058574 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDH2 pAb (ATL-HPA058574 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CDH2 pAb (ATL-HPA058574 w/enhanced validation)
Datasheet Anti CDH2 pAb (ATL-HPA058574 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDH2 pAb (ATL-HPA058574 w/enhanced validation)
Citations for Anti CDH2 pAb (ATL-HPA058574 w/enhanced validation) – 1 Found
Gao, Fucun; Tian, Juan. FOXK1, Regulated by miR-365-3p, Promotes Cell Growth and EMT Indicates Unfavorable Prognosis in Breast Cancer. Oncotargets And Therapy. 13( 32021304):623-634.  PubMed