Anti CDH2 pAb (ATL-HPA058574 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA058574-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: CDH2
Alternative Gene Name: CD325, CDHN, NCAD
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024304: 99%, ENSRNOG00000015602: 99%
Entrez Gene ID: 1000
Uniprot ID: P19022
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP |
Gene Sequence | NSNDGLVTVVKPIDFETNRMFVLTVAAENQVPLAKGIQHPPQSTATVSVTVIDVNENPYFAPNPKIIRQEEGLHAGTMLTTFTAQDP |
Gene ID - Mouse | ENSMUSG00000024304 |
Gene ID - Rat | ENSRNOG00000015602 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDH2 pAb (ATL-HPA058574 w/enhanced validation) | |
Datasheet | Anti CDH2 pAb (ATL-HPA058574 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CDH2 pAb (ATL-HPA058574 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CDH2 pAb (ATL-HPA058574 w/enhanced validation) | |
Datasheet | Anti CDH2 pAb (ATL-HPA058574 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CDH2 pAb (ATL-HPA058574 w/enhanced validation) |
Citations for Anti CDH2 pAb (ATL-HPA058574 w/enhanced validation) – 1 Found |
Gao, Fucun; Tian, Juan. FOXK1, Regulated by miR-365-3p, Promotes Cell Growth and EMT Indicates Unfavorable Prognosis in Breast Cancer. Oncotargets And Therapy. 13( 32021304):623-634. PubMed |