Anti CDH19 pAb (ATL-HPA056332)

Atlas Antibodies

Catalog No.:
ATL-HPA056332-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cadherin 19, type 2
Gene Name: CDH19
Alternative Gene Name: CDH7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047216: 70%, ENSRNOG00000029841: 74%
Entrez Gene ID: 28513
Uniprot ID: Q9H159
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DYSIEEDDSQTFDIITNHETQEGIVILKKKVDFEHQNHYGIRAKVKNHHVPEQLMKYHTEASTTFIKIQV
Gene Sequence DYSIEEDDSQTFDIITNHETQEGIVILKKKVDFEHQNHYGIRAKVKNHHVPEQLMKYHTEASTTFIKIQV
Gene ID - Mouse ENSMUSG00000047216
Gene ID - Rat ENSRNOG00000029841
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDH19 pAb (ATL-HPA056332)
Datasheet Anti CDH19 pAb (ATL-HPA056332) Datasheet (External Link)
Vendor Page Anti CDH19 pAb (ATL-HPA056332) at Atlas Antibodies

Documents & Links for Anti CDH19 pAb (ATL-HPA056332)
Datasheet Anti CDH19 pAb (ATL-HPA056332) Datasheet (External Link)
Vendor Page Anti CDH19 pAb (ATL-HPA056332)