Anti CDH17 pAb (ATL-HPA026556 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA026556-25
  • Immunohistochemistry analysis in human duodenum and liver tissues using HPA026556 antibody. Corresponding CDH17 RNA-seq data are presented for the same tissues.
  • Western blot analysis in human cell lines Caco-2 and SK-MEL-30 using Anti-CDH17 antibody. Corresponding CDH17 RNA-seq data are presented for the same cell lines. Loading control: Anti-HDAC1.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cadherin 17, LI cadherin (liver-intestine)
Gene Name: CDH17
Alternative Gene Name: cadherin, HPT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028217: 80%, ENSRNOG00000015562: 80%
Entrez Gene ID: 1015
Uniprot ID: Q12864
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GTKVGNVTAKDPEGLDISYSLRGDTRGWLKIDHVTGEIFSVAPLDREAGSPYRVQVVATEVGGSSLSSVSEFHLILMDVNDNPPRLAKDYT
Gene Sequence GTKVGNVTAKDPEGLDISYSLRGDTRGWLKIDHVTGEIFSVAPLDREAGSPYRVQVVATEVGGSSLSSVSEFHLILMDVNDNPPRLAKDYT
Gene ID - Mouse ENSMUSG00000028217
Gene ID - Rat ENSRNOG00000015562
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDH17 pAb (ATL-HPA026556 w/enhanced validation)
Datasheet Anti CDH17 pAb (ATL-HPA026556 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDH17 pAb (ATL-HPA026556 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CDH17 pAb (ATL-HPA026556 w/enhanced validation)
Datasheet Anti CDH17 pAb (ATL-HPA026556 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDH17 pAb (ATL-HPA026556 w/enhanced validation)



Citations for Anti CDH17 pAb (ATL-HPA026556 w/enhanced validation) – 1 Found
Fang, Yi; Xu, Xiaojiang; Ding, Jun; Yang, Lu; Doan, Mary T; Karmaus, Peer W F; Snyder, Nathaniel W; Zhao, Yingming; Li, Jian-Liang; Li, Xiaoling. Histone crotonylation promotes mesoendodermal commitment of human embryonic stem cells. Cell Stem Cell. 2021;28(4):748-763.e7.  PubMed