Anti CDH17 pAb (ATL-HPA023616 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023616-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: CDH17
Alternative Gene Name: cadherin, HPT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028217: 81%, ENSRNOG00000015562: 82%
Entrez Gene ID: 1015
Uniprot ID: Q12864
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDREEKDAYVFYAVAKDEYGKPLSYPLEIHVKVK |
| Gene Sequence | HPIKITQVRWNDPGAQYSLVDKEKLPRFPFSIDQEGDIYVTQPLDREEKDAYVFYAVAKDEYGKPLSYPLEIHVKVK |
| Gene ID - Mouse | ENSMUSG00000028217 |
| Gene ID - Rat | ENSRNOG00000015562 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDH17 pAb (ATL-HPA023616 w/enhanced validation) | |
| Datasheet | Anti CDH17 pAb (ATL-HPA023616 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDH17 pAb (ATL-HPA023616 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CDH17 pAb (ATL-HPA023616 w/enhanced validation) | |
| Datasheet | Anti CDH17 pAb (ATL-HPA023616 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDH17 pAb (ATL-HPA023616 w/enhanced validation) |
| Citations for Anti CDH17 pAb (ATL-HPA023616 w/enhanced validation) – 2 Found |
| Bian, Tingting; Zhao, Jinli; Feng, Jia; Zhang, Qing; Qian, Li; Liu, Jian; Jiang, Daishan; Liu, Yifei; Zhang, Jianguo. Combination of cadherin-17 and SATB homeobox 2 serves as potential optimal makers for the differential diagnosis of pulmonary enteric adenocarcinoma and metastatic colorectal adenocarcinoma. Oncotarget. 2017;8(38):63442-63452. PubMed |
| Magnusson, Kristina; de Wit, Meike; Brennan, Donal J; Johnson, Louis B; McGee, Sharon F; Lundberg, Emma; Naicker, Kirsha; Klinger, Rut; Kampf, Caroline; Asplund, Anna; Wester, Kenneth; Gry, Marcus; Bjartell, Anders; Gallagher, William M; Rexhepaj, Elton; Kilpinen, Sami; Kallioniemi, Olli-Pekka; Belt, Eric; Goos, Jeroen; Meijer, Gerrit; Birgisson, Helgi; Glimelius, Bengt; Borrebaeck, Carl A K; Navani, Sanjay; Uhlén, Mathias; O'Connor, Darran P; Jirström, Karin; Pontén, Fredrik. SATB2 in combination with cytokeratin 20 identifies over 95% of all colorectal carcinomas. The American Journal Of Surgical Pathology. 2011;35(7):937-48. PubMed |