Anti CDH17 pAb (ATL-HPA023614 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA023614-25

• 
• 

Protein Description: cadherin 17, LI cadherin (liver-intestine)
Gene Name: CDH17
Alternative Gene Name: cadherin, HPT-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028217: 83%, ENSRNOG00000015562: 83%
Entrez Gene ID: 1015
Uniprot ID: Q12864
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: INNVMYFQINNKTGAISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWKAPKPVEMVENSTDP
• Gene Sequence: INNVMYFQINNKTGAISLTREGSQELNPAKNPSYNLVISVKDMGGQSENSFSDTTSVDIIVTENIWKAPKPVEMVENSTDP
• Gene ID - Mouse: ENSMUSG00000028217
• Gene ID - Rat: ENSRNOG00000015562
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.