Anti CDH15 pAb (ATL-HPA070961)

Atlas Antibodies

Catalog No.: ATL-HPA070961-25

Protein Description: cadherin 15, type 1, M-cadherin (myotubule)
Gene Name: CDH15
Alternative Gene Name: CDH14, CDH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031962: 80%, ENSRNOG00000027954: 79%
Entrez Gene ID: 1013
Uniprot ID: P55291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LSIVKALDYESCEHYELKVSVQNEAPLQAAALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVAT
• Gene Sequence: LSIVKALDYESCEHYELKVSVQNEAPLQAAALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVAT
• Gene ID - Mouse: ENSMUSG00000031962
• Gene ID - Rat: ENSRNOG00000027954
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.