Anti CDH15 pAb (ATL-HPA070961)

Atlas Antibodies

SKU:
ATL-HPA070961-25
  • Immunofluorescent staining of human cell line RH-30 shows localization to cytosol & the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cadherin 15, type 1, M-cadherin (myotubule)
Gene Name: CDH15
Alternative Gene Name: CDH14, CDH3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031962: 80%, ENSRNOG00000027954: 79%
Entrez Gene ID: 1013
Uniprot ID: P55291
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LSIVKALDYESCEHYELKVSVQNEAPLQAAALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVAT
Gene Sequence LSIVKALDYESCEHYELKVSVQNEAPLQAAALRAERGQAKVRVHVQDTNEPPVFQENPLRTSLAEGAPPGTLVAT
Gene ID - Mouse ENSMUSG00000031962
Gene ID - Rat ENSRNOG00000027954
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDH15 pAb (ATL-HPA070961)
Datasheet Anti CDH15 pAb (ATL-HPA070961) Datasheet (External Link)
Vendor Page Anti CDH15 pAb (ATL-HPA070961) at Atlas Antibodies

Documents & Links for Anti CDH15 pAb (ATL-HPA070961)
Datasheet Anti CDH15 pAb (ATL-HPA070961) Datasheet (External Link)
Vendor Page Anti CDH15 pAb (ATL-HPA070961)