Anti CDH1 pAb (ATL-HPA004812 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA004812-25
- Shipping:
- Calculated at Checkout
$328.00
Gene Name: CDH1
Alternative Gene Name: CD324, UVO, uvomorulin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000303: 76%, ENSRNOG00000020151: 80%
Entrez Gene ID: 999
Uniprot ID: P12830
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA |
| Gene Sequence | ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIIDADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKINLKLMDNQNKDQVTTLEVSVCDCEGA |
| Gene ID - Mouse | ENSMUSG00000000303 |
| Gene ID - Rat | ENSRNOG00000020151 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDH1 pAb (ATL-HPA004812 w/enhanced validation) | |
| Datasheet | Anti CDH1 pAb (ATL-HPA004812 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDH1 pAb (ATL-HPA004812 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CDH1 pAb (ATL-HPA004812 w/enhanced validation) | |
| Datasheet | Anti CDH1 pAb (ATL-HPA004812 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDH1 pAb (ATL-HPA004812 w/enhanced validation) |
| Citations for Anti CDH1 pAb (ATL-HPA004812 w/enhanced validation) – 7 Found |
| Bajikar, Sameer S; Wang, Chun-Chao; Borten, Michael A; Pereira, Elizabeth J; Atkins, Kristen A; Janes, Kevin A. Tumor-Suppressor Inactivation of GDF11 Occurs by Precursor Sequestration in Triple-Negative Breast Cancer. Developmental Cell. 2017;43(4):418-435.e13. PubMed |
| Kawamura, Eiko; Hamilton, Gina B; Miskiewicz, Ewa I; MacPhee, Daniel J. Fermitin family homolog-2 (FERMT2) is highly expressed in human placental villi and modulates trophoblast invasion. Bmc Developmental Biology. 2018;18(1):19. PubMed |
| Sannigrahi, Malay K; Srinivas, Cheerneni S; Deokate, Nilesh; Rakshit, Sabyasachi. The strong propensity of Cadherin-23 for aggregation inhibits cell migration. Molecular Oncology. 2019;13(5):1092-1109. PubMed |
| Meloni, Marisa; Buratti, Paolo; Carriero, Francesco; Ceriotti, Laura. In Vitro Modelling of Barrier Impairment Associated with Gastro-Oesophageal Reflux Disease (GERD). Clinical And Experimental Gastroenterology. 14( 34526798):361-373. PubMed |
| Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476. PubMed |
| Xiong, Yujing; Hu, Linli; Zhang, Tao; Wang, Mengying; Xu, Hui; Li, Tin Chiu; Sun, Yingpu; Wang, Chi Chiu. Effects of high progesterone in in-vitro fertilization cycle on DNA methylation and gene expression of adhesion molecules on endometrium during implantation window. Journal Of Assisted Reproduction And Genetics. 2020;37(1):33-43. PubMed |
| Gao, Fucun; Tian, Juan. FOXK1, Regulated by miR-365-3p, Promotes Cell Growth and EMT Indicates Unfavorable Prognosis in Breast Cancer. Oncotargets And Therapy. 13( 32021304):623-634. PubMed |