Anti CDCP2 pAb (ATL-HPA031143)

Atlas Antibodies

Catalog No.:
ATL-HPA031143-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: CUB domain containing protein 2
Gene Name: CDCP2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047636: 90%, ENSRNOG00000009221: 91%
Entrez Gene ID: 200008
Uniprot ID: Q5VXM1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RGNFSSPQYPSSYPNNIRCHWTIRLPPGYQVKVFFLDLDLEEPNSLTKTCDFDHLAAFDGASEEAPLLGNWCGHHLPPPVTSSHNQ
Gene Sequence RGNFSSPQYPSSYPNNIRCHWTIRLPPGYQVKVFFLDLDLEEPNSLTKTCDFDHLAAFDGASEEAPLLGNWCGHHLPPPVTSSHNQ
Gene ID - Mouse ENSMUSG00000047636
Gene ID - Rat ENSRNOG00000009221
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDCP2 pAb (ATL-HPA031143)
Datasheet Anti CDCP2 pAb (ATL-HPA031143) Datasheet (External Link)
Vendor Page Anti CDCP2 pAb (ATL-HPA031143) at Atlas Antibodies

Documents & Links for Anti CDCP2 pAb (ATL-HPA031143)
Datasheet Anti CDCP2 pAb (ATL-HPA031143) Datasheet (External Link)
Vendor Page Anti CDCP2 pAb (ATL-HPA031143)