Anti CDCA8 pAb (ATL-HPA028783 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA028783-25

Protein Description: cell division cycle associated 8
Gene Name: CDCA8
Alternative Gene Name: BOR, DasraB, FLJ12042, MESRGP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028873: 81%, ENSRNOG00000031431: 82%
Entrez Gene ID: 55143
Uniprot ID: Q53HL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LRTPAAGERIYNISGNGSPLADSKEIFLTVPVGGGESLRLLASDLQRHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK
• Gene Sequence: LRTPAAGERIYNISGNGSPLADSKEIFLTVPVGGGESLRLLASDLQRHSIAQLDPEALGNIKKLSNRLAQICSSIRTHK
• Gene ID - Mouse: ENSMUSG00000028873
• Gene ID - Rat: ENSRNOG00000031431
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDCA8 pAb (ATL-HPA028783 w/enhanced validation) – 1 Found

Shen, Peilin; He, Xuejun; Lan, Lin; Hong, Yingkai; Lin, Mingen. Identification of cell division cycle 20 as a candidate biomarker and potential therapeutic target in bladder cancer using bioinformatics analysis. Bioscience Reports. 2020;40(7)