Anti CDCA8 pAb (ATL-HPA028120 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA028120-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: cell division cycle associated 8
Gene Name: CDCA8
Alternative Gene Name: BOR, DasraB, FLJ12042, MESRGP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028873: 64%, ENSRNOG00000031431: 66%
Entrez Gene ID: 55143
Uniprot ID: Q53HL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLKSAKTRKVIQVDEMIVEEEEEEENERKNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVSMVKPTPGLTPRFDSR
Gene Sequence PLKSAKTRKVIQVDEMIVEEEEEEENERKNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVSMVKPTPGLTPRFDSR
Gene ID - Mouse ENSMUSG00000028873
Gene ID - Rat ENSRNOG00000031431
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDCA8 pAb (ATL-HPA028120 w/enhanced validation)
Datasheet Anti CDCA8 pAb (ATL-HPA028120 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDCA8 pAb (ATL-HPA028120 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CDCA8 pAb (ATL-HPA028120 w/enhanced validation)
Datasheet Anti CDCA8 pAb (ATL-HPA028120 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CDCA8 pAb (ATL-HPA028120 w/enhanced validation)
Citations for Anti CDCA8 pAb (ATL-HPA028120 w/enhanced validation) – 1 Found
Shen, Peilin; He, Xuejun; Lan, Lin; Hong, Yingkai; Lin, Mingen. Identification of cell division cycle 20 as a candidate biomarker and potential therapeutic target in bladder cancer using bioinformatics analysis. Bioscience Reports. 2020;40(7)  PubMed