Anti CDCA8 pAb (ATL-HPA028120 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA028120-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: CDCA8
Alternative Gene Name: BOR, DasraB, FLJ12042, MESRGP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028873: 64%, ENSRNOG00000031431: 66%
Entrez Gene ID: 55143
Uniprot ID: Q53HL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | PLKSAKTRKVIQVDEMIVEEEEEEENERKNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVSMVKPTPGLTPRFDSR |
| Gene Sequence | PLKSAKTRKVIQVDEMIVEEEEEEENERKNLQTARVKRCPPSKKRTQSIQGKGKGKRSSRANTVTPAVGRLEVSMVKPTPGLTPRFDSR |
| Gene ID - Mouse | ENSMUSG00000028873 |
| Gene ID - Rat | ENSRNOG00000031431 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDCA8 pAb (ATL-HPA028120 w/enhanced validation) | |
| Datasheet | Anti CDCA8 pAb (ATL-HPA028120 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDCA8 pAb (ATL-HPA028120 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CDCA8 pAb (ATL-HPA028120 w/enhanced validation) | |
| Datasheet | Anti CDCA8 pAb (ATL-HPA028120 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDCA8 pAb (ATL-HPA028120 w/enhanced validation) |
| Citations for Anti CDCA8 pAb (ATL-HPA028120 w/enhanced validation) – 1 Found |
| Shen, Peilin; He, Xuejun; Lan, Lin; Hong, Yingkai; Lin, Mingen. Identification of cell division cycle 20 as a candidate biomarker and potential therapeutic target in bladder cancer using bioinformatics analysis. Bioscience Reports. 2020;40(7) PubMed |