Anti CDCA7L pAb (ATL-HPA074623)
Atlas Antibodies
- Catalog No.:
- ATL-HPA074623-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CDCA7L
Alternative Gene Name: JPO2, R1, RAM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021175: 78%, ENSRNOG00000005410: 79%
Entrez Gene ID: 55536
Uniprot ID: Q96GN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MELATRYQIPKEVADIFNAPSDDEEFVGFRDDVPMETLSSEESCDSFDSLESGKQQDV |
| Gene Sequence | MELATRYQIPKEVADIFNAPSDDEEFVGFRDDVPMETLSSEESCDSFDSLESGKQQDV |
| Gene ID - Mouse | ENSMUSG00000021175 |
| Gene ID - Rat | ENSRNOG00000005410 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDCA7L pAb (ATL-HPA074623) | |
| Datasheet | Anti CDCA7L pAb (ATL-HPA074623) Datasheet (External Link) |
| Vendor Page | Anti CDCA7L pAb (ATL-HPA074623) at Atlas Antibodies |
| Documents & Links for Anti CDCA7L pAb (ATL-HPA074623) | |
| Datasheet | Anti CDCA7L pAb (ATL-HPA074623) Datasheet (External Link) |
| Vendor Page | Anti CDCA7L pAb (ATL-HPA074623) |