Anti CDCA7L pAb (ATL-HPA074623)

Atlas Antibodies

Catalog No.: ATL-HPA074623-25

Protein Description: cell division cycle associated 7 like
Gene Name: CDCA7L
Alternative Gene Name: JPO2, R1, RAM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021175: 78%, ENSRNOG00000005410: 79%
Entrez Gene ID: 55536
Uniprot ID: Q96GN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MELATRYQIPKEVADIFNAPSDDEEFVGFRDDVPMETLSSEESCDSFDSLESGKQQDV
• Gene Sequence: MELATRYQIPKEVADIFNAPSDDEEFVGFRDDVPMETLSSEESCDSFDSLESGKQQDV
• Gene ID - Mouse: ENSMUSG00000021175
• Gene ID - Rat: ENSRNOG00000005410
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.