Anti CDCA7L pAb (ATL-HPA074623)

Atlas Antibodies

Catalog No.:
ATL-HPA074623-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cell division cycle associated 7 like
Gene Name: CDCA7L
Alternative Gene Name: JPO2, R1, RAM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021175: 78%, ENSRNOG00000005410: 79%
Entrez Gene ID: 55536
Uniprot ID: Q96GN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MELATRYQIPKEVADIFNAPSDDEEFVGFRDDVPMETLSSEESCDSFDSLESGKQQDV
Gene Sequence MELATRYQIPKEVADIFNAPSDDEEFVGFRDDVPMETLSSEESCDSFDSLESGKQQDV
Gene ID - Mouse ENSMUSG00000021175
Gene ID - Rat ENSRNOG00000005410
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDCA7L pAb (ATL-HPA074623)
Datasheet Anti CDCA7L pAb (ATL-HPA074623) Datasheet (External Link)
Vendor Page Anti CDCA7L pAb (ATL-HPA074623) at Atlas Antibodies

Documents & Links for Anti CDCA7L pAb (ATL-HPA074623)
Datasheet Anti CDCA7L pAb (ATL-HPA074623) Datasheet (External Link)
Vendor Page Anti CDCA7L pAb (ATL-HPA074623)