Anti CDCA7L pAb (ATL-HPA027169)

Atlas Antibodies

SKU:
ATL-HPA027169-25
  • Immunohistochemical staining of human appendix shows strong nuclear positivity in lymphoid reaction center cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleus & nucleoli.
  • Western blot analysis in human cell line NTERA-2.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cell division cycle associated 7-like
Gene Name: CDCA7L
Alternative Gene Name: JPO2, R1, RAM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021175: 60%, ENSRNOG00000005410: 57%
Entrez Gene ID: 55536
Uniprot ID: Q96GN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VRFHSKYFTEELRRIFIEDTDSETEDFAGFTQSDLNGKTNPEVMVVESDLSDDGKASLVSEEEEDEEEDKATPRRSRSRRSSIGLRVAFQFPTKKLANKPDKNSSSEQLFSSARLQNEKKTILERKKDCRQVIQREDSTSESE
Gene Sequence VRFHSKYFTEELRRIFIEDTDSETEDFAGFTQSDLNGKTNPEVMVVESDLSDDGKASLVSEEEEDEEEDKATPRRSRSRRSSIGLRVAFQFPTKKLANKPDKNSSSEQLFSSARLQNEKKTILERKKDCRQVIQREDSTSESE
Gene ID - Mouse ENSMUSG00000021175
Gene ID - Rat ENSRNOG00000005410
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDCA7L pAb (ATL-HPA027169)
Datasheet Anti CDCA7L pAb (ATL-HPA027169) Datasheet (External Link)
Vendor Page Anti CDCA7L pAb (ATL-HPA027169) at Atlas Antibodies

Documents & Links for Anti CDCA7L pAb (ATL-HPA027169)
Datasheet Anti CDCA7L pAb (ATL-HPA027169) Datasheet (External Link)
Vendor Page Anti CDCA7L pAb (ATL-HPA027169)