Anti CDCA5 pAb (ATL-HPA023691)
Atlas Antibodies
- Catalog No.:
- ATL-HPA023691-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CDCA5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024791: 66%, ENSRNOG00000046635: 64%
Entrez Gene ID: 113130
Uniprot ID: Q96FF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVR |
| Gene Sequence | SILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVR |
| Gene ID - Mouse | ENSMUSG00000024791 |
| Gene ID - Rat | ENSRNOG00000046635 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDCA5 pAb (ATL-HPA023691) | |
| Datasheet | Anti CDCA5 pAb (ATL-HPA023691) Datasheet (External Link) |
| Vendor Page | Anti CDCA5 pAb (ATL-HPA023691) at Atlas Antibodies |
| Documents & Links for Anti CDCA5 pAb (ATL-HPA023691) | |
| Datasheet | Anti CDCA5 pAb (ATL-HPA023691) Datasheet (External Link) |
| Vendor Page | Anti CDCA5 pAb (ATL-HPA023691) |
| Citations for Anti CDCA5 pAb (ATL-HPA023691) – 3 Found |
| Shen, Zhiqing; Yu, Xueping; Zheng, Yijuan; Lai, Xueping; Li, Julan; Hong, Yuxiang; Zhang, Huatang; Chen, Chunlin; Su, Zhijun; Guo, Ruyi. CDCA5 regulates proliferation in hepatocellular carcinoma and has potential as a negative prognostic marker. Oncotargets And Therapy. 11( 29503564):891-901. PubMed |
| Chen, Huaping; Wu, Junrong; Lu, Liuyi; Hu, Zuojian; Li, Xi; Huang, Li; Zhang, Xiaolian; Chen, Mingxing; Qin, Xue; Xie, Li. Identification of Hub Genes Associated With Immune Infiltration and Predict Prognosis in Hepatocellular Carcinoma via Bioinformatics Approaches. Frontiers In Genetics. 11( 33505422):575762. PubMed |
| Kariri, Yousif A; Joseph, Chitra; Alsaleem, Mansour A; Elsharawy, Khloud A; Alsaeed, Sami; Toss, Michael S; Mongan, Nigel P; Green, Andrew R; Rakha, Emad A. Mechanistic and Clinical Evidence Supports a Key Role for Cell Division Cycle Associated 5 (CDCA5) as an Independent Predictor of Outcome in Invasive Breast Cancer. Cancers. 2022;14(22) PubMed |