Anti CDCA5 pAb (ATL-HPA023691)

Atlas Antibodies

Catalog No.: ATL-HPA023691-25

Protein Description: cell division cycle associated 5
Gene Name: CDCA5
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024791: 66%, ENSRNOG00000046635: 64%
Entrez Gene ID: 113130
Uniprot ID: Q96FF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVR
• Gene Sequence: SILPEIWPKTPSAAAVRKPIVLKRIVAHAVEVPAVQSPRRSPRISFFLEKENEPPGRELTKEDLFKTHSVPATPTSTPVPNPEAESSSKEGELDARDLEMSKKVR
• Gene ID - Mouse: ENSMUSG00000024791
• Gene ID - Rat: ENSRNOG00000046635
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDCA5 pAb (ATL-HPA023691) – 3 Found

Shen, Zhiqing; Yu, Xueping; Zheng, Yijuan; Lai, Xueping; Li, Julan; Hong, Yuxiang; Zhang, Huatang; Chen, Chunlin; Su, Zhijun; Guo, Ruyi. CDCA5 regulates proliferation in hepatocellular carcinoma and has potential as a negative prognostic marker. Oncotargets And Therapy. 11( 29503564):891-901. 

Chen, Huaping; Wu, Junrong; Lu, Liuyi; Hu, Zuojian; Li, Xi; Huang, Li; Zhang, Xiaolian; Chen, Mingxing; Qin, Xue; Xie, Li. Identification of Hub Genes Associated With Immune Infiltration and Predict Prognosis in Hepatocellular Carcinoma via Bioinformatics Approaches. Frontiers In Genetics. 11( 33505422):575762. 

Kariri, Yousif A; Joseph, Chitra; Alsaleem, Mansour A; Elsharawy, Khloud A; Alsaeed, Sami; Toss, Michael S; Mongan, Nigel P; Green, Andrew R; Rakha, Emad A. Mechanistic and Clinical Evidence Supports a Key Role for Cell Division Cycle Associated 5 (CDCA5) as an Independent Predictor of Outcome in Invasive Breast Cancer. Cancers. 2022;14(22)