Anti CDCA4 pAb (ATL-HPA064971)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064971-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CDCA4
Alternative Gene Name: FLJ20764, Hepp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047832: 78%, ENSRNOG00000013898: 72%
Entrez Gene ID: 55038
Uniprot ID: Q9BXL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VDSPYYDLDTVLTGMMGGARPGPCEGLEGLAPATPGPSSSCKSDLGELDHVVEILVET |
| Gene Sequence | VDSPYYDLDTVLTGMMGGARPGPCEGLEGLAPATPGPSSSCKSDLGELDHVVEILVET |
| Gene ID - Mouse | ENSMUSG00000047832 |
| Gene ID - Rat | ENSRNOG00000013898 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDCA4 pAb (ATL-HPA064971) | |
| Datasheet | Anti CDCA4 pAb (ATL-HPA064971) Datasheet (External Link) |
| Vendor Page | Anti CDCA4 pAb (ATL-HPA064971) at Atlas Antibodies |
| Documents & Links for Anti CDCA4 pAb (ATL-HPA064971) | |
| Datasheet | Anti CDCA4 pAb (ATL-HPA064971) Datasheet (External Link) |
| Vendor Page | Anti CDCA4 pAb (ATL-HPA064971) |