Anti CDCA4 pAb (ATL-HPA064971)
Atlas Antibodies
- Catalog No.:
- ATL-HPA064971-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: CDCA4
Alternative Gene Name: FLJ20764, Hepp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047832: 78%, ENSRNOG00000013898: 72%
Entrez Gene ID: 55038
Uniprot ID: Q9BXL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VDSPYYDLDTVLTGMMGGARPGPCEGLEGLAPATPGPSSSCKSDLGELDHVVEILVET |
Gene Sequence | VDSPYYDLDTVLTGMMGGARPGPCEGLEGLAPATPGPSSSCKSDLGELDHVVEILVET |
Gene ID - Mouse | ENSMUSG00000047832 |
Gene ID - Rat | ENSRNOG00000013898 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDCA4 pAb (ATL-HPA064971) | |
Datasheet | Anti CDCA4 pAb (ATL-HPA064971) Datasheet (External Link) |
Vendor Page | Anti CDCA4 pAb (ATL-HPA064971) at Atlas Antibodies |
Documents & Links for Anti CDCA4 pAb (ATL-HPA064971) | |
Datasheet | Anti CDCA4 pAb (ATL-HPA064971) Datasheet (External Link) |
Vendor Page | Anti CDCA4 pAb (ATL-HPA064971) |