Anti CDCA4 pAb (ATL-HPA059416)

Atlas Antibodies

Catalog No.: ATL-HPA059416-25

Protein Description: cell division cycle associated 4
Gene Name: CDCA4
Alternative Gene Name: FLJ20764, Hepp
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047832: 83%, ENSRNOG00000013898: 85%
Entrez Gene ID: 55038
Uniprot ID: Q9BXL8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQEEMTQDGTWRTVAPQAAERAPLDRLVSTEILCRA
• Gene Sequence: LKTVSSYSLQRQSLLDMSLVKLQLCHMLVEPNLCRSVLIANTVRQIQEEMTQDGTWRTVAPQAAERAPLDRLVSTEILCRA
• Gene ID - Mouse: ENSMUSG00000047832
• Gene ID - Rat: ENSRNOG00000013898
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.