Anti CDCA3 pAb (ATL-HPA026587 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA026587-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CDCA3
Alternative Gene Name: GRCC8, TOME-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023505: 78%, ENSRNOG00000015529: 80%
Entrez Gene ID: 83461
Uniprot ID: Q99618
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQ |
| Gene Sequence | KEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSPGTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQ |
| Gene ID - Mouse | ENSMUSG00000023505 |
| Gene ID - Rat | ENSRNOG00000015529 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDCA3 pAb (ATL-HPA026587 w/enhanced validation) | |
| Datasheet | Anti CDCA3 pAb (ATL-HPA026587 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDCA3 pAb (ATL-HPA026587 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti CDCA3 pAb (ATL-HPA026587 w/enhanced validation) | |
| Datasheet | Anti CDCA3 pAb (ATL-HPA026587 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti CDCA3 pAb (ATL-HPA026587 w/enhanced validation) |
| Citations for Anti CDCA3 pAb (ATL-HPA026587 w/enhanced validation) – 3 Found |
| Kildey, Katrina; Gandhi, Neha S; Sahin, Katherine B; Shah, Esha T; Boittier, Eric; Duijf, Pascal H G; Molloy, Christopher; Burgess, Joshua T; Beard, Sam; Bolderson, Emma; Suraweera, Amila; Richard, Derek J; O'Byrne, Kenneth J; Adams, Mark N. Elevating CDCA3 levels in non-small cell lung cancer enhances sensitivity to platinum-based chemotherapy. Communications Biology. 2021;4(1):638. PubMed |
| Sahin, Katherine B; Shah, Esha T; Ferguson, Genevieve P; Molloy, Christopher; Kalita-de Croft, Priyakshi; Hayes, Sarah A; Hudson, Amanda; Colvin, Emily; Kamitakahara, Hannah; Harvie, Rozelle; Hasovits, Csilla; Khan, Tashbib; Duijf, Pascal H G; Howell, Viive M; He, Yaowu; Bolderson, Emma; Hooper, John D; Lakhani, Sunil R; Richard, Derek J; O'Byrne, Kenneth J; Adams, Mark N. Elevating CDCA3 Levels Enhances Tyrosine Kinase Inhibitor Sensitivity in TKI-Resistant EGFR Mutant Non-Small-Cell Lung Cancer. Cancers. 2021;13(18) PubMed |
| Barbhuiya, Tabassum Khair; Fisher, Mark; Boittier, Eric D; Bolderson, Emma; O'Byrne, Kenneth J; Richard, Derek J; Adams, Mark Nathaniel; Gandhi, Neha S. Structural investigation of CDCA3-Cdh1 protein-protein interactions using in vitro studies and molecular dynamics simulation. Protein Science : A Publication Of The Protein Society. 2023;32(3):e4572. PubMed |