Anti CDCA2 pAb (ATL-HPA030049)
Atlas Antibodies
- Catalog No.:
- ATL-HPA030049-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: CDCA2
Alternative Gene Name: PPP1R81, Repo-Man
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048922: 44%, ENSRNOG00000025302: 46%
Entrez Gene ID: 157313
Uniprot ID: Q69YH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IKCERKDDFLGAAEGKLQCNRLMPNSQKDCHCLGDVLIENTKESKSQSEDLGRKPMESSSVVSCRDRKDRRRSMCYSDGRSLHLEKNGNHTPSS |
| Gene Sequence | IKCERKDDFLGAAEGKLQCNRLMPNSQKDCHCLGDVLIENTKESKSQSEDLGRKPMESSSVVSCRDRKDRRRSMCYSDGRSLHLEKNGNHTPSS |
| Gene ID - Mouse | ENSMUSG00000048922 |
| Gene ID - Rat | ENSRNOG00000025302 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CDCA2 pAb (ATL-HPA030049) | |
| Datasheet | Anti CDCA2 pAb (ATL-HPA030049) Datasheet (External Link) |
| Vendor Page | Anti CDCA2 pAb (ATL-HPA030049) at Atlas Antibodies |
| Documents & Links for Anti CDCA2 pAb (ATL-HPA030049) | |
| Datasheet | Anti CDCA2 pAb (ATL-HPA030049) Datasheet (External Link) |
| Vendor Page | Anti CDCA2 pAb (ATL-HPA030049) |
| Citations for Anti CDCA2 pAb (ATL-HPA030049) – 5 Found |
| Vallardi, Giulia; Allan, Lindsey A; Crozier, Lisa; Saurin, Adrian T. Division of labour between PP2A-B56 isoforms at the centromere and kinetochore. Elife. 2019;8( 30829571) PubMed |
| Yu, Zhenjun; Zhang, Yu; Shao, Shuai; Liu, Qi; Li, Yuhan; Du, Xiaoxiao; Zhang, Kun; Zhang, Mengxia; Yuan, Haixia; Yuan, Qiang; Liu, Tong; Gao, Yingtang; Wang, Yijun; Hong, Wei; Han, Tao. Identification of CDCA2 as a Diagnostic and Prognostic Marker for Hepatocellular Carcinoma. Frontiers In Oncology. 11( 34660326):755814. PubMed |
| Qian, Junbin; Beullens, Monique; Huang, Jin; De Munter, Sofie; Lesage, Bart; Bollen, Mathieu. Cdk1 orders mitotic events through coordination of a chromosome-associated phosphatase switch. Nature Communications. 2015;6( 26674376):10215. PubMed |
| Manzione, Maria Giulia; Rombouts, Jan; Steklov, Mikhail; Pasquali, Lorenzo; Sablina, Anna; Gelens, Lendert; Qian, Junbin; Bollen, Mathieu. Co-regulation of the antagonistic RepoMan:Aurora-B pair in proliferating cells. Molecular Biology Of The Cell. 2020;31(6):419-438. PubMed |
| Wang, Xinru; Garvanska, Dimitriya H; Nasa, Isha; Ueki, Yumi; Zhang, Gang; Kettenbach, Arminja N; Peti, Wolfgang; Nilsson, Jakob; Page, Rebecca. A dynamic charge-charge interaction modulates PP2A:B56 substrate recruitment. Elife. 2020;9( 32195664) PubMed |