Anti CDCA2 pAb (ATL-HPA030049)

Atlas Antibodies

SKU: ATL-HPA030049-25

• 

Protein Description: cell division cycle associated 2
Gene Name: CDCA2
Alternative Gene Name: PPP1R81, Repo-Man
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048922: 44%, ENSRNOG00000025302: 46%
Entrez Gene ID: 157313
Uniprot ID: Q69YH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IKCERKDDFLGAAEGKLQCNRLMPNSQKDCHCLGDVLIENTKESKSQSEDLGRKPMESSSVVSCRDRKDRRRSMCYSDGRSLHLEKNGNHTPSS
• Gene Sequence: IKCERKDDFLGAAEGKLQCNRLMPNSQKDCHCLGDVLIENTKESKSQSEDLGRKPMESSSVVSCRDRKDRRRSMCYSDGRSLHLEKNGNHTPSS
• Gene ID - Mouse: ENSMUSG00000048922
• Gene ID - Rat: ENSRNOG00000025302
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDCA2 pAb (ATL-HPA030049) – 5 Found

Vallardi, Giulia; Allan, Lindsey A; Crozier, Lisa; Saurin, Adrian T. Division of labour between PP2A-B56 isoforms at the centromere and kinetochore. Elife. 2019;8( 30829571) 

Yu, Zhenjun; Zhang, Yu; Shao, Shuai; Liu, Qi; Li, Yuhan; Du, Xiaoxiao; Zhang, Kun; Zhang, Mengxia; Yuan, Haixia; Yuan, Qiang; Liu, Tong; Gao, Yingtang; Wang, Yijun; Hong, Wei; Han, Tao. Identification of CDCA2 as a Diagnostic and Prognostic Marker for Hepatocellular Carcinoma. Frontiers In Oncology. 11( 34660326):755814. 

Qian, Junbin; Beullens, Monique; Huang, Jin; De Munter, Sofie; Lesage, Bart; Bollen, Mathieu. Cdk1 orders mitotic events through coordination of a chromosome-associated phosphatase switch. Nature Communications. 2015;6( 26674376):10215. 

Manzione, Maria Giulia; Rombouts, Jan; Steklov, Mikhail; Pasquali, Lorenzo; Sablina, Anna; Gelens, Lendert; Qian, Junbin; Bollen, Mathieu. Co-regulation of the antagonistic RepoMan:Aurora-B pair in proliferating cells. Molecular Biology Of The Cell. 2020;31(6):419-438. 

Wang, Xinru; Garvanska, Dimitriya H; Nasa, Isha; Ueki, Yumi; Zhang, Gang; Kettenbach, Arminja N; Peti, Wolfgang; Nilsson, Jakob; Page, Rebecca. A dynamic charge-charge interaction modulates PP2A:B56 substrate recruitment. Elife. 2020;9( 32195664)