Anti CDCA2 pAb (ATL-HPA026293)

Atlas Antibodies

SKU: ATL-HPA026293-25

• 
• 

Protein Description: cell division cycle associated 2
Gene Name: CDCA2
Alternative Gene Name: PPP1R81, Repo-Man
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048922: 40%, ENSRNOG00000025302: 40%
Entrez Gene ID: 157313
Uniprot ID: Q69YH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VLSSKRRRISYQRDSDENLTDAEGKVIGLQIFNIDTDRACAVETSVDLSEISSKLGSTQSGFLVEESLPLSELTETSNALKVADCVVGKGSS
• Gene Sequence: VLSSKRRRISYQRDSDENLTDAEGKVIGLQIFNIDTDRACAVETSVDLSEISSKLGSTQSGFLVEESLPLSELTETSNALKVADCVVGKGSS
• Gene ID - Mouse: ENSMUSG00000048922
• Gene ID - Rat: ENSRNOG00000025302
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.