Anti CDCA2 pAb (ATL-HPA026293)

Atlas Antibodies

Catalog No.:
ATL-HPA026293-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cell division cycle associated 2
Gene Name: CDCA2
Alternative Gene Name: PPP1R81, Repo-Man
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048922: 40%, ENSRNOG00000025302: 40%
Entrez Gene ID: 157313
Uniprot ID: Q69YH5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VLSSKRRRISYQRDSDENLTDAEGKVIGLQIFNIDTDRACAVETSVDLSEISSKLGSTQSGFLVEESLPLSELTETSNALKVADCVVGKGSS
Gene Sequence VLSSKRRRISYQRDSDENLTDAEGKVIGLQIFNIDTDRACAVETSVDLSEISSKLGSTQSGFLVEESLPLSELTETSNALKVADCVVGKGSS
Gene ID - Mouse ENSMUSG00000048922
Gene ID - Rat ENSRNOG00000025302
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDCA2 pAb (ATL-HPA026293)
Datasheet Anti CDCA2 pAb (ATL-HPA026293) Datasheet (External Link)
Vendor Page Anti CDCA2 pAb (ATL-HPA026293) at Atlas Antibodies

Documents & Links for Anti CDCA2 pAb (ATL-HPA026293)
Datasheet Anti CDCA2 pAb (ATL-HPA026293) Datasheet (External Link)
Vendor Page Anti CDCA2 pAb (ATL-HPA026293)