Anti CDC73 pAb (ATL-HPA069324)

Atlas Antibodies

Catalog No.:
ATL-HPA069324-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: cell division cycle 73
Gene Name: CDC73
Alternative Gene Name: C1orf28, FIHP, HRPT1, HRPT2, parafibromin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026361: 100%, ENSRNOG00000003258: 100%
Entrez Gene ID: 79577
Uniprot ID: Q6P1J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen WDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKYDEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSHL
Gene Sequence WDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKYDEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSHL
Gene ID - Mouse ENSMUSG00000026361
Gene ID - Rat ENSRNOG00000003258
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDC73 pAb (ATL-HPA069324)
Datasheet Anti CDC73 pAb (ATL-HPA069324) Datasheet (External Link)
Vendor Page Anti CDC73 pAb (ATL-HPA069324) at Atlas Antibodies

Documents & Links for Anti CDC73 pAb (ATL-HPA069324)
Datasheet Anti CDC73 pAb (ATL-HPA069324) Datasheet (External Link)
Vendor Page Anti CDC73 pAb (ATL-HPA069324)