Anti CDC73 pAb (ATL-HPA069324)

Atlas Antibodies

Catalog No.: ATL-HPA069324-25

Protein Description: cell division cycle 73
Gene Name: CDC73
Alternative Gene Name: C1orf28, FIHP, HRPT1, HRPT2, parafibromin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026361: 100%, ENSRNOG00000003258: 100%
Entrez Gene ID: 79577
Uniprot ID: Q6P1J9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKYDEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSHL
• Gene Sequence: WDRVVAVFVQGPAWQFKGWPWLLPDGSPVDIFAKIKAFHLKYDEVRLDPNVQKWDVTVLELSYHKRHLDRPVFLRFWETLDRYMVKHKSHL
• Gene ID - Mouse: ENSMUSG00000026361
• Gene ID - Rat: ENSRNOG00000003258
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.