Anti CDC7 pAb (ATL-HPA035831)

Atlas Antibodies

SKU:
ATL-HPA035831-25
  • Immunohistochemical staining of human cerebellum shows strong nuclear positivity in cells in molecular layer.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, cytokinetic bridge & mitotic spindle.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: cell division cycle 7
Gene Name: CDC7
Alternative Gene Name: CDC7L1, HsCdc7, Hsk1, huCdc7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029283: 95%, ENSRNOG00000002105: 96%
Entrez Gene ID: 8317
Uniprot ID: O00311
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREY
Gene Sequence ATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREY
Gene ID - Mouse ENSMUSG00000029283
Gene ID - Rat ENSRNOG00000002105
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CDC7 pAb (ATL-HPA035831)
Datasheet Anti CDC7 pAb (ATL-HPA035831) Datasheet (External Link)
Vendor Page Anti CDC7 pAb (ATL-HPA035831) at Atlas Antibodies

Documents & Links for Anti CDC7 pAb (ATL-HPA035831)
Datasheet Anti CDC7 pAb (ATL-HPA035831) Datasheet (External Link)
Vendor Page Anti CDC7 pAb (ATL-HPA035831)