Anti CDC6 pAb (ATL-HPA065070)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065070-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: CDC6
Alternative Gene Name: CDC18L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017499: 87%, ENSRNOG00000027787: 85%
Entrez Gene ID: 990
Uniprot ID: Q99741
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | RLNQVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSPSEPLIPKRVGLIHISQVISEVDGNRM |
Gene Sequence | RLNQVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSPSEPLIPKRVGLIHISQVISEVDGNRM |
Gene ID - Mouse | ENSMUSG00000017499 |
Gene ID - Rat | ENSRNOG00000027787 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CDC6 pAb (ATL-HPA065070) | |
Datasheet | Anti CDC6 pAb (ATL-HPA065070) Datasheet (External Link) |
Vendor Page | Anti CDC6 pAb (ATL-HPA065070) at Atlas Antibodies |
Documents & Links for Anti CDC6 pAb (ATL-HPA065070) | |
Datasheet | Anti CDC6 pAb (ATL-HPA065070) Datasheet (External Link) |
Vendor Page | Anti CDC6 pAb (ATL-HPA065070) |