Anti CDC6 pAb (ATL-HPA065070)

Atlas Antibodies

Catalog No.:
ATL-HPA065070-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cell division cycle 6
Gene Name: CDC6
Alternative Gene Name: CDC18L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017499: 87%, ENSRNOG00000027787: 85%
Entrez Gene ID: 990
Uniprot ID: Q99741
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLNQVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSPSEPLIPKRVGLIHISQVISEVDGNRM
Gene Sequence RLNQVSRDQVLDNAAVQFCARKVSAVSGDVRKALDVCRRAIEIVESDVKSQTILKPLSECKSPSEPLIPKRVGLIHISQVISEVDGNRM
Gene ID - Mouse ENSMUSG00000017499
Gene ID - Rat ENSRNOG00000027787
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CDC6 pAb (ATL-HPA065070)
Datasheet Anti CDC6 pAb (ATL-HPA065070) Datasheet (External Link)
Vendor Page Anti CDC6 pAb (ATL-HPA065070) at Atlas Antibodies

Documents & Links for Anti CDC6 pAb (ATL-HPA065070)
Datasheet Anti CDC6 pAb (ATL-HPA065070) Datasheet (External Link)
Vendor Page Anti CDC6 pAb (ATL-HPA065070)