Anti CDC5L pAb (ATL-HPA011361)

Atlas Antibodies

Catalog No.: ATL-HPA011361-25

Protein Description: cell division cycle 5-like
Gene Name: CDC5L
Alternative Gene Name: CDC5, CEF1, hCDC5, PCDC5RP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023932: 99%, ENSRNOG00000019975: 98%
Entrez Gene ID: 988
Uniprot ID: Q99459
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILR
• Gene Sequence: GAEGLTPRSGTTPKPVINSTPGRTPLRDKLNINPEDGMADYSDPSYVKQMERESREHLRLGLLGLPAPKNDFEIVLPENAEKELEEREIDDTYIEDAADVDARKQAIRDAERVKEMKRMHKAVQKDLPRPSEVNETILR
• Gene ID - Mouse: ENSMUSG00000023932
• Gene ID - Rat: ENSRNOG00000019975
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CDC5L pAb (ATL-HPA011361) – 2 Found

Martinez-Gil, Luis; Vera-Velasco, Natalia M; Mingarro, Ismael. Exploring the Human-Nipah Virus Protein-Protein Interactome. Journal Of Virology. 2017;91(23) 

Jokoji, Go; Maeda, Shingo; Oishi, Kazuki; Ijuin, Toshiro; Nakajima, Masahiro; Tawaratsumida, Hiroki; Kawamura, Ichiro; Tominaga, Hiroyuki; Taketomi, Eiji; Ikegawa, Shiro; Taniguchi, Noboru. CDC5L promotes early chondrocyte differentiation and proliferation by modulating pre-mRNA splicing of SOX9, COL2A1, and WEE1. The Journal Of Biological Chemistry. 2021;297(2):100994.